Transcription Factor
Accessions: | CG31670 (FlyZincFinger 1.0 ) |
Names: | CG31670 |
Organisms: | Drosophila melanogaster |
Libraries: | FlyZincFinger 1.0 1 1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed] |
Notes: | family:Cys2His2 zinc finger |
Length: | 167 |
Pfam Domains: | 2-22 C2H2-type zinc finger 3-23 C2H2-type zinc finger 3-22 Zinc finger, C2H2 type 17-41 Zinc-finger double domain 31-45 C2H2-type zinc finger 31-53 C2H2-type zinc finger 31-53 Zinc finger, C2H2 type 48-69 Zinc-finger double domain 58-79 C2H2-type zinc finger 59-81 Zinc finger, C2H2 type 59-78 C2H2-type zinc finger 74-97 Zinc-finger double domain 87-109 Zinc finger, C2H2 type 87-109 C2H2-type zinc finger 101-125 Zinc-finger double domain 115-137 Zinc finger, C2H2 type 115-125 C2H2-type zinc finger 115-138 C2H2-type zinc finger 129-152 Zinc-finger double domain 143-166 Zinc finger, C2H2 type 143-166 C2H2-type zinc finger |
Sequence: (in bold interface residues) | 1 KTFSCLECGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTSEKPHK 60 61 CQTCGKAFNRSSTLNTHSRIHAGYKPFVCEYCGKGFHQKGNYKNHKLTHSGEKAYKCNIC 120 121 NKAFHQVYNLTFHMHTHNDKKPYTCRVCAKGFCRNFDLKKHMRKLHE |
Interface Residues: | 3, 12, 13, 14, 15, 16, 17, 18, 19, 20, 41, 42, 43, 44, 45, 47, 48, 49, 50, 51, 52, 54, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 80, 82, 97, 98, 99, 100, 101, 103, 104, 126, 127, 128, 129, 131, 132, 154, 155, 156, 157, 158, 159, 160 |
3D-footprint Homologues: | 2kmk_A, 6wmi_A, 1tf3_A, 8ssu_A, 1tf6_A, 5v3j_F, 8gn3_A, 5ei9_F, 1mey_C, 5k5i_A, 7w1m_H, 5und_A, 2lt7_A, 2i13_A, 8ssq_A, 1ubd_C, 6jnm_A, 2gli_A, 6ml4_A, 4x9j_A, 6blw_A, 5kkq_D, 2wbs_A, 5kl3_A, 1f2i_J, 4m9v_C, 7eyi_G, 6e94_A, 7ysf_A, 6a57_A, 5yel_A, 2jpa_A, 8cuc_F, 7y3l_A, 1g2f_F, 1llm_D, 7txc_E, 7y3m_I, 7n5w_A, 3uk3_C, 5k5l_F, 6u9q_A, 5yj3_D, 8h9h_G, 2drp_D |
Binding Motifs: | CG31670_SANGER_5_FBgn0031375 AAAwGmgCAwC CG31670_SOLEXA_5_FBgn0031375 ymAAAwGAGCAAycv |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.