Transcription Factor

Accessions: CG31670 (FlyZincFinger 1.0 )
Names: CG31670
Organisms: Drosophila melanogaster
Libraries: FlyZincFinger 1.0 1
1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed]
Notes: family:Cys2His2 zinc finger
Length: 167
Pfam Domains: 2-22 C2H2-type zinc finger
3-23 C2H2-type zinc finger
3-22 Zinc finger, C2H2 type
17-41 Zinc-finger double domain
31-53 C2H2-type zinc finger
31-53 Zinc finger, C2H2 type
31-45 C2H2-type zinc finger
48-69 Zinc-finger double domain
58-79 C2H2-type zinc finger
59-78 C2H2-type zinc finger
59-81 Zinc finger, C2H2 type
74-97 Zinc-finger double domain
87-109 Zinc finger, C2H2 type
87-109 C2H2-type zinc finger
101-125 Zinc-finger double domain
115-137 Zinc finger, C2H2 type
115-125 C2H2-type zinc finger
115-138 C2H2-type zinc finger
129-152 Zinc-finger double domain
143-166 Zinc finger, C2H2 type
143-166 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 KTFSCLECGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTSEKPHK 60
61 CQTCGKAFNRSSTLNTHSRIHAGYKPFVCEYCGKGFHQKGNYKNHKLTHSGEKAYKCNIC 120
121 NKAFHQVYNLTFHMHTHNDKKPYTCRVCAKGFCRNFDLKKHMRKLHE
Interface Residues: 3, 13, 14, 15, 16, 17, 19, 20, 41, 42, 43, 44, 45, 47, 48, 49, 50, 51, 52, 54, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 80, 82, 97, 98, 99, 100, 101, 103, 104, 126, 127, 128, 129, 131, 132, 154, 155, 156, 157, 158, 159, 160
3D-footprint Homologues: 2kmk_A, 1tf3_A, 5k5i_A, 5v3j_F, 7w1m_H, 8ssu_A, 8gn3_A, 1tf6_A, 5ei9_F, 8ssq_A, 2lt7_A, 1ubd_C, 6jnm_A, 5kl3_A, 6ml4_A, 6blw_A, 4x9j_A, 2gli_A, 1f2i_J, 5kkq_D, 2wbs_A, 4m9v_C, 7ysf_A, 6e94_A, 6a57_A, 5yel_A, 2jpa_A, 8cuc_F, 7y3l_A, 1g2f_F, 7txc_E, 1llm_D, 7y3m_I, 3uk3_C, 7n5w_A, 5k5l_F, 6u9q_A, 5yj3_D, 8h9h_G, 2drp_D
Binding Motifs: CG31670_SANGER_5_FBgn0031375 AAAwGmgCAwC
CG31670_SOLEXA_5_FBgn0031375 ymAAAwGAGCAAycv
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.