Transcription Factor

Accessions: 1mnm_C (3D-footprint 20250804), 1mnm_D (3D-footprint 20250804)
Names: Alpha-2 repressor, MAT ALPHA-2 TRANSCRIPTIONAL REPRESSOR, MATalpha2 protein, Mating-type protein ALPHA2, MTAL2_YEAST
Organisms: Saccharomyces cerevisiae, Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Libraries: 3D-footprint 20250804 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P0CY08
Length: 77
Pfam Domains: 23-76 Homeobox domain
35-73 Homeobox KN domain
Sequence:
(in bold interface residues)
1 GLVFNVVTQDMINKSTKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLS 60
61 RIQIKNWVSNRRRKEKT
Interface Residues: 17, 18, 19, 20, 21, 22, 23, 62, 63, 65, 66, 69, 70, 73, 74
3D-footprint Homologues: 6m3d_C, 2lkx_A, 3d1n_M, 8pmf_A, 1mnm_C, 1k61_B, 1le8_B, 4j19_B, 2ld5_A, 5jlw_D, 1ig7_A, 2xsd_C, 7q3o_C, 7xrc_C, 2hdd_A, 4xrs_G, 1nk2_P, 8g87_X, 6es3_K, 3rkq_B, 7psx_B, 5flv_I, 3a01_E, 1puf_B, 1b72_A, 6fqp_B, 3cmy_A, 1zq3_P, 1du0_A, 9b8u_A, 6fqq_E, 4xrm_B, 5zjt_E, 2hos_A
Binding Motifs: 1mnm_ABCD ATTrCCTAnnnnGGAAATTTACAA
1mnm_C ATTTACAa
Binding Sites: 1mnm_E
1mnm_F
Publications: Tan S, Richmond T.J. Crystal structure of the yeast MATalpha2/MCM1/DNA ternary complex. Nature 391:660-6 (1998). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.