Transcription Factor

Accessions: Q8NDX6 (JASPAR 2024)
Names: OriLyt TD-element-binding protein 7, Zinc finger protein 740, ZN740_HUMAN
Organisms: Homo sapiens
Libraries: JASPAR 2024 1
1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Uniprot: Q8NDX6
Length: 193
Pfam Domains: 101-123 Zinc finger, C2H2 type
101-123 C2H2-type zinc finger
115-138 Zinc-finger double domain
129-151 Zinc finger, C2H2 type
129-151 C2H2-type zinc finger
143-167 Zinc-finger double domain
157-178 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 MAQASLLACEGLAGVSLVPTAASKKMMLSQIASKQAENGERAGSPDVLRCSSQGHRKDSD 60
61 KSRSRKDDDSLSEASHSKKTVKKVVVVEQNGSFQVKIPKNFVCEHCFGAFRSSYHLKRHI 120
121 LIHTGEKPFECDICDMRFIQKYHLERHKRVHSGEKPYQCERCHQCFSRTDRLLRHKRMCQ 180
181 GCQSKTSDGQFSL
Interface Residues: 101, 111, 112, 113, 114, 115, 117, 118, 120, 121, 124, 139, 140, 141, 142, 143, 145, 146, 147, 168, 169, 170, 171, 172, 173, 174, 175
3D-footprint Homologues: 2kmk_A, 7y3l_A, 1tf3_A, 7n5w_A, 6jnm_A, 5v3j_F, 3uk3_C, 8cuc_F, 5kkq_D, 8gn3_A, 4x9j_A, 2gli_A, 5kl3_A, 1tf6_A, 5ei9_F, 1g2f_F, 7ysf_A, 6ml4_A, 1ubd_C, 8ssq_A, 7w1m_H, 5k5i_A, 6u9q_A, 8ssu_A, 8h9h_G, 6e94_A, 2lt7_A, 7y3m_I, 6a57_A, 6blw_A, 2jpa_A, 5yj3_D, 1f2i_J, 2wbs_A, 7txc_E, 1llm_D, 5yel_A, 2drp_D, 4m9v_C
Binding Motifs: MA0753.1 mCCCCCCCAc
MA0753.2 cyrCCCCCCCCAc
MA0753.3 CCCCCCCCAc
Publications: Weirauch MT, Cote A, Norel R, Annala M, Zhao Y, Riley TR, Saez-Rodriguez J, Cokelaer T, Vedenko A, Talukder S; DREAM5 Consortium, Bussemaker HJ, Morris QD, Bulyk ML, Stolovitzky G, Hughes TR. Evaluation of methods for modeling transcription factor sequence specificity. Nat Biotechnol 31:126-34 (2013). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.