Transcription Factor

Accessions: 4wu4_A (3D-footprint 20250804), 4wu4_B (3D-footprint 20250804), 4wuh_B (3D-footprint 20250804)
Names: D4EMQ0_ENTFL, Response regulator receiver domain protein
Organisms: Enterococcus faecalis S613
Libraries: 3D-footprint 20250804 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: R3G073
Length: 68
Pfam Domains: 4-49 Sigma-70, region 4
5-61 Bacterial regulatory proteins, luxR family
Sequence:
(in bold interface residues)
1 MVLHEDLTNREHEILMLIAQGKSNQEIADELFITLKTVKTHVSNILAKLDVDNRTQAAIY 60
61 AFQHGLAK
Interface Residues: 24, 34, 35, 36, 37, 39, 40, 41, 42, 43, 44
3D-footprint Homologues: 1l3l_A, 8u3b_G, 7ve5_B, 5w43_B, 8dq1_C, 8hml_B, 6ide_A, 1zlk_A, 4wuh_B
Binding Motifs: 4wu4_AB TCGTnCnnnaGnCC
4wu4_B GwrCra
4wuh_B TCGtnCt
Binding Sites: 4wu4_G / 4wuh_G
4wu4_H
4wuh_C
Publications: Davlieva M, Shi Y, Leonard P.G, Johnson T.A, Zianni M.R, Arias C.A, Ladbury J.E, Shamoo Y. A variable DNA recognition site organization establishes the LiaR-mediated cell envelope stress response of enterococci to daptomycin. Nucleic acids research 43:4758-73 (2015). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.