Transcription Factor
| Accessions: | 4wu4_A (3D-footprint 20250804), 4wu4_B (3D-footprint 20250804), 4wuh_B (3D-footprint 20250804) |
| Names: | D4EMQ0_ENTFL, Response regulator receiver domain protein |
| Organisms: | Enterococcus faecalis S613 |
| Libraries: | 3D-footprint 20250804 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | R3G073 |
| Length: | 68 |
| Pfam Domains: | 4-49 Sigma-70, region 4 5-61 Bacterial regulatory proteins, luxR family |
| Sequence: (in bold interface residues) | 1 MVLHEDLTNREHEILMLIAQGKSNQEIADELFITLKTVKTHVSNILAKLDVDNRTQAAIY 60 61 AFQHGLAK |
| Interface Residues: | 24, 34, 35, 36, 37, 39, 40, 41, 42, 43, 44 |
| 3D-footprint Homologues: | 1l3l_A, 8u3b_G, 7ve5_B, 5w43_B, 8dq1_C, 8hml_B, 6ide_A, 1zlk_A, 4wuh_B |
| Binding Motifs: | 4wu4_AB TCGTnCnnnaGnCC 4wu4_B GwrCra 4wuh_B TCGtnCt |
| Binding Sites: | 4wu4_G / 4wuh_G 4wu4_H 4wuh_C |
| Publications: | Davlieva M, Shi Y, Leonard P.G, Johnson T.A, Zianni M.R, Arias C.A, Ladbury J.E, Shamoo Y. A variable DNA recognition site organization establishes the LiaR-mediated cell envelope stress response of enterococci to daptomycin. Nucleic acids research 43:4758-73 (2015). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.