Transcription Factor

Accessions: 1r0o_B (3D-footprint 20250804)
Names: 20-hydroxy-ecdysone receptor, 20E receptor, Ecdysone receptor, Ecdysteroid receptor, ECR_DROME, EcRH, Nuclear receptor subfamily 1 group H member 1
Organisms: Drosophila melanogaster
Libraries: 3D-footprint 20250804 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P34021
Length: 78
Pfam Domains: 3-70 Zinc finger, C4 type (two domains)
Sequence:
(in bold interface residues)
1 EELCLVCGDRASGYHYNALTCEGCKGFFRRSVTKSAVYCCKFGRACEMDMYMRRKCQECR 60
61 LKKCLAVGMRPECVVPEN
Interface Residues: 12, 13, 15, 16, 22, 23, 25, 26, 29, 30, 54
3D-footprint Homologues: 6fbq_A, 6l6q_B, 7wnh_D, 1lo1_A, 3g9m_B, 1a6y_A, 4oln_B, 2ff0_A, 1dsz_A, 4umm_E, 3cbb_A, 7xvn_C, 4iqr_B, 2han_A, 1hcq_E, 8cef_H, 5krb_G, 2han_B, 1kb2_B, 2a66_A, 8hbm_B, 2nll_B, 1lat_A, 7xv6_B, 4hn5_B, 8rm6_A, 5emc_A, 7prw_B, 5cbx_B, 3g6t_A, 1r4i_A, 5cbz_E, 4tnt_B, 5e69_A
Binding Motifs: 1r0o_AB GTCAnTGACC
1r0o_B TgaCC
Binding Sites: 1r0o_C
1r0o_D
Publications: Devarakonda S, Harp J.M, Kim Y, Ozyhar A, Rastinejad F. Structure of the heterodimeric ecdysone receptor DNA-binding complex. The EMBO journal 22:5827-40 (2003). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.