Transcription Factor
| Accessions: | 1r0o_B (3D-footprint 20231221) |
| Names: | 20-hydroxy-ecdysone receptor, 20E receptor, Ecdysone receptor, Ecdysteroid receptor, ECR_DROME, EcRH, Nuclear receptor subfamily 1 group H member 1 |
| Organisms: | Drosophila melanogaster |
| Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P34021 |
| Length: | 78 |
| Pfam Domains: | 3-70 Zinc finger, C4 type (two domains) |
| Sequence: (in bold interface residues) | 1 EELCLVCGDRASGYHYNALTCEGCKGFFRRSVTKSAVYCCKFGRACEMDMYMRRKCQECR 60 61 LKKCLAVGMRPECVVPEN |
| Interface Residues: | 12, 13, 15, 16, 22, 23, 25, 26, 29, 30, 54 |
| 3D-footprint Homologues: | 6fbq_A, 6l6q_B, 7wnh_D, 1a6y_A, 1lo1_A, 3g9m_B, 4oln_B, 2a66_A, 2nll_B, 1lat_A, 7xv6_B, 2ff0_A, 1dsz_A, 4umm_E, 3cbb_A, 8cef_H, 4iqr_B, 2han_A, 1hcq_E, 8hbm_B, 5krb_G, 2han_B, 1kb2_B, 4tnt_B, 5e69_A, 4hn5_B, 5emc_A, 7prw_B, 5cbx_B, 3g6t_A, 1r4i_A, 5cbz_E |
| Binding Motifs: | 1r0o_AB GTCAnTGACC 1r0o_B TgaCC |
| Binding Sites: | 1r0o_C 1r0o_D |
| Publications: | Devarakonda S, Harp J.M, Kim Y, Ozyhar A, Rastinejad F. Structure of the heterodimeric ecdysone receptor DNA-binding complex. The EMBO journal 22:5827-40 (2003). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.