Transcription Factor

						

			
Accessions: ZNF75A_DBD (HumanTF 1.0), ZNF75A (HT-SELEX2 May2017)

			
Names: ZN75A_HUMAN, ZNF75A, ENSG00000162086
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1, HT-SELEX2 May2017 2
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]

2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Uniprot: Q96N20
Notes: Ensembl ID: ENSG00000162086; DNA-binding domain sequence; TF family: znfC2H2; Clone source: Gene synthesis, TF family: KRAB_Znf_C2H2  experiment: HT-SELEX Hamming distance: 1 cycle: 2, TF family: KRAB_Znf_C2H2 experiment: HT-SELEX Hamming distance: 1 cycle: 4, TF family: KRAB_Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 2, TF family: KRAB_Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 4
Length: 151
Pfam Domains:      4-25 Zinc-finger double domain
    16-38 C2H2-type zinc finger
    16-36 C2H2-type zinc finger
    16-38 Zinc finger, C2H2 type
    31-53 Zinc-finger double domain
    43-66 C2H2-type zinc finger
    44-66 Zinc finger, C2H2 type
    44-66 C2H2-type zinc finger
    58-82 Zinc-finger double domain
    71-94 C2H2-type zinc finger
    72-94 Zinc finger, C2H2 type
    72-94 C2H2-type zinc finger
   89-110 Zinc-finger double domain
   99-122 C2H2-type zinc finger
  100-122 Zinc finger, C2H2 type
  100-122 C2H2-type zinc finger
  114-138 Zinc-finger double domain
  127-150 C2H2-type zinc finger
  128-150 Zinc finger, C2H2 type
  128-150 C2H2-type zinc finger
Sequence: 
(in bold interface residues)		   1 KLMDRHKKDCAREKPFKCQECGKTFRVSSDLIKHQRIHTEEKPYKCQQCDKRFRWSSDLN   60
  61 KHLTTHQGIKPYKCSWCGKSFSQNTNLHTHQRTHTGEKPFTCHECGKKFSQNSHLIKHRR  120
 121 THTGEQPYTCSICRRNFSRRSSLLRHQKLHL
Interface Residues: 5, 16, 26, 27, 28, 29, 30, 31, 32, 33, 34, 37, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 67, 82, 83, 84, 85, 86, 88, 89, 110, 111, 112, 113, 114, 116, 117, 119, 121, 122, 138, 139, 140, 141, 142, 143, 144, 145
3D-footprint Homologues: 7w1m_H, 2kmk_A, 6jnm_A, 5v3j_F, 8ssq_A, 5und_A, 8ssu_A, 5kkq_D, 5ei9_F, 6wmi_A, 5k5i_A, 4m9v_C, 2lt7_A, 1tf6_A, 2i13_A, 6a57_A, 5yel_A, 7n5w_A, 2gli_A, 5k5l_F, 6ml4_A, 4x9j_A, 8gn3_A, 6blw_A, 2drp_D, 1f2i_J, 7eyi_G, 8h9h_G, 6e94_A, 7ysf_A, 2jpa_A, 1ubd_C, 1tf3_A, 8cuc_F, 7y3l_A, 3uk3_C, 1g2f_F, 1llm_D, 6u9q_A, 1mey_C, 7txc_E, 5kl3_A, 7y3m_I, 2wbs_A, 5yj3_D
Binding Motifs: ZNF75A_DBD gcTTTTCCCACA
ZNF75A_2 mGcTTTTCCCACam
ZNF75A_4 mGCTTTTCCCACAc
ZNF75A_methyl_1 mGCTTTTCCCACac
ZNF75A_methyl_3 aGCTTTTCCCACAy
			
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.