Transcription Factor
Accessions: | ZNF75A_DBD (HumanTF 1.0), ZNF75A (HT-SELEX2 May2017) |
Names: | ZN75A_HUMAN, ZNF75A, ENSG00000162086 |
Organisms: | Homo sapiens |
Libraries: | HumanTF 1.0 1, HT-SELEX2 May2017 2 1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] 2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
Uniprot: | Q96N20 |
Notes: | Ensembl ID: ENSG00000162086; DNA-binding domain sequence; TF family: znfC2H2; Clone source: Gene synthesis, TF family: KRAB_Znf_C2H2 experiment: HT-SELEX Hamming distance: 1 cycle: 2, TF family: KRAB_Znf_C2H2 experiment: HT-SELEX Hamming distance: 1 cycle: 4, TF family: KRAB_Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 2, TF family: KRAB_Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 4 |
Length: | 151 |
Pfam Domains: | 4-25 Zinc-finger double domain 16-38 C2H2-type zinc finger 16-36 C2H2-type zinc finger 16-38 Zinc finger, C2H2 type 31-53 Zinc-finger double domain 43-66 C2H2-type zinc finger 44-66 C2H2-type zinc finger 44-66 Zinc finger, C2H2 type 58-82 Zinc-finger double domain 71-94 C2H2-type zinc finger 72-94 Zinc finger, C2H2 type 72-94 C2H2-type zinc finger 89-110 Zinc-finger double domain 99-122 C2H2-type zinc finger 100-122 Zinc finger, C2H2 type 100-122 C2H2-type zinc finger 114-138 Zinc-finger double domain 127-150 C2H2-type zinc finger 128-150 Zinc finger, C2H2 type 128-150 C2H2-type zinc finger |
Sequence: (in bold interface residues) | 1 KLMDRHKKDCAREKPFKCQECGKTFRVSSDLIKHQRIHTEEKPYKCQQCDKRFRWSSDLN 60 61 KHLTTHQGIKPYKCSWCGKSFSQNTNLHTHQRTHTGEKPFTCHECGKKFSQNSHLIKHRR 120 121 THTGEQPYTCSICRRNFSRRSSLLRHQKLHL |
Interface Residues: | 5, 16, 26, 27, 28, 29, 30, 32, 33, 37, 54, 55, 56, 57, 58, 60, 61, 63, 64, 65, 67, 82, 83, 84, 85, 86, 89, 110, 111, 112, 113, 114, 117, 119, 121, 122, 124, 125, 138, 139, 140, 141, 142, 144, 145 |
3D-footprint Homologues: | 7w1m_H, 2kmk_A, 5v3j_F, 8ssq_A, 8ssu_A, 2lt7_A, 1tf6_A, 7n5w_A, 8gn3_A, 2gli_A, 2drp_D, 8h9h_G, 7ysf_A, 6e94_A, 2jpa_A, 1ubd_C, 7y3l_A, 1tf3_A, 8cuc_F, 7txc_E, 6u9q_A, 7y3m_I, 1yuj_A |
Binding Motifs: | ZNF75A_DBD gcTTTTCCCACA ZNF75A_2 mGcTTTTCCCACam ZNF75A_4 mGCTTTTCCCACAc ZNF75A_methyl_1 mGCTTTTCCCACac ZNF75A_methyl_3 aGCTTTTCCCACAy |
Publications: | Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.