Transcription Factor

Accessions: 1t2k_D (3D-footprint 20260701)
Names: Activating transcription factor 2, ATF2_HUMAN, cAMP response element-binding protein CRE-BP1, cAMP-dependent transcription factor ATF-2, cAMP-responsive element-binding protein 2, CREB-2, Cyclic AMP-dependent transcription factor ATF-2, Cyclic AMP-responsive element-binding protein 2, Cyclic-AMP-dependent transcription factor ATF-2, HB16
Organisms: Homo sapiens
Libraries: 3D-footprint 20260701 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P15336
Length: 61
Pfam Domains: 1-58 bZIP transcription factor
7-51 Basic region leucine zipper
Sequence:
(in bold interface residues)
1 KRRKFLERNRAAASRSRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLL 60
61 A
Interface Residues: 2, 5, 9, 10, 12, 13, 16, 17
3D-footprint Homologues: 8k86_A, 2wt7_A, 6mg1_B, 5t01_B, 1dh3_C, 5vpe_D, 2dgc_A
Binding Motifs: 1t2k_ABCD TTTAAnTTTnnnnATGTCAA
1t2k_D TTGACA
Binding Sites: 1t2k_E
1t2k_F
Publications: Panne D, Maniatis T, Harrison S.C. Crystal structure of ATF-2/c-Jun and IRF-3 bound to the interferon-beta enhancer. The EMBO journal 23:4384-93 (2004). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.