Transcription Factor

Accessions: P54821 (JASPAR 2024)
Names: Homeobox protein PHOX1, Paired mesoderm homeobox protein 1, Paired-related homeobox protein 1, PRRX1_HUMAN, PRX-1
Organisms: Homo sapiens
Libraries: JASPAR 2024 1
1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Uniprot: P54821
Length: 245
Pfam Domains: 95-151 Homeobox domain
219-236 OAR domain
Sequence:
(in bold interface residues)
1 MTSSYGHVLERQPALGGRLDSPGNLDTLQAKKNFSVSHLLDLEEAGDMVAAQADENVGEA 60
61 GRSLLESPGLTSGSDTPQQDNDQLNSEEKKKRKQRRNRTTFNSSQLQALERVFERTHYPD 120
121 AFVREDLARRVNLTEARVQVWFQNRRAKFRRNERAMLANKNASLLKSYSGDVTAVEQPIV 180
181 PRPAPRPTDYLSWGTASPYSAMATYSATCANNSPAQGINMANSIANLRLKAKEYSLQRNQ 240
241 VPTVN
Interface Residues: 35, 37, 38, 81, 94, 95, 96, 97, 98, 136, 137, 139, 140, 143, 144, 146, 147, 148, 151
3D-footprint Homologues: 7vwz_G, 5zfz_A, 4j19_B, 6a8r_A, 1puf_A, 8ejp_B, 3cmy_A, 1fjl_B, 3d1n_M, 1ig7_A, 8pmf_A, 1jgg_B, 2lkx_A, 6m3d_C, 1nk2_P, 1zq3_P, 3lnq_A, 7q3o_C, 6es3_K, 2ld5_A, 3a01_E, 2h8r_B, 8ik5_C, 5jlw_D, 3rkq_B, 9b8u_A, 4xrs_G, 2hdd_A, 8osb_E, 1au7_A, 4cyc_A, 2r5y_A, 1puf_B, 8eml_B, 5flv_I, 2hos_A, 8pi8_B, 1b72_A, 7psx_B, 5hod_A, 1e3o_C, 1le8_A, 7xrc_C, 2xsd_C, 1o4x_A, 8bx1_A, 1du0_A, 4qtr_D, 5zjt_E, 8g87_X
Binding Motifs: MA0716.1 yyAATTAr
MA0716.2 yAATTA
Publications: Noyes M.B, Christensen R.G, Wakabayashi A, Stormo G.D, Brodsky M.H, Wolfe S.A. Analysis of homeodomain specificities allows the family-wide prediction of preferred recognition sites. Cell 133:1277-89 (2008). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.