Transcription Factor
| Accessions: | MYB44 (Athamap 20091028), T24976 (AthalianaCistrome v4_May2016), Q9FDW1 (JASPAR 2024) |
| Names: | AtMYB44, AtMYBR1, Myb-related protein 44, Myb-related protein R1, MYB44, Transcription factor MYB44, AT5G67300, T24976;, MYB44_ARATH |
| Organisms: | Arabidopsis thaliana |
| Libraries: | Athamap 20091028 1, AthalianaCistrome v4_May2016 2, JASPAR 2024 3 1 Bulow L, Engelmann S, Schindler M, Hehl R. AthaMap, integrating transcriptional and post-transcriptional data. Nucleic acids research 37:D983-6 (2009). [Pubmed] 2 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed] 3 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Uniprot: | Q9FDW1 |
| Notes: | ecotype:Col-0, experiment type: ampDAP-seq, experiment type: ampDAP-seq (methyl-cytosines removed by PCR), experiment type: DAP-seq, family:MYB |
| Length: | 305 |
| Pfam Domains: | 6-51 Myb-like DNA-binding domain 9-67 Myb-like DNA-binding domain 60-102 Myb-like DNA-binding domain 61-107 Myb-like DNA-binding domain |
| Sequence: (in bold interface residues) | 1 MADRIKGPWSPEEDEQLRRLVVKYGPRNWTVISKSIPGRSGKSCRLRWCNQLSPQVEHRP 60 61 FSAEEDETIARAHAQFGNKWATIARLLNGRTDNAVKNHWNSTLKRKCGGYDHRGYDGSED 120 121 HRPVKRSVSAGSPPVVTGLYMSPGSPTGSDVSDSSTIPILPSVELFKPVPRPGAVVLPLP 180 181 IETSSSSDDPPTSLSLSLPGADVSEESNRSHESTNINNTTSSRHNHNNTVSFMPFSGGFR 240 241 GAIEEMGKSFPGNGGEFMAVVQEMIKAEVRSYMTEMQRNNGGGFVGGFIDNGMIPMSQIG 300 301 VGRIE |
| Interface Residues: | 6, 40, 41, 42, 43, 45, 46, 49, 50, 51, 92, 93, 96, 97, 100, 101, 102 |
| 3D-footprint Homologues: | 1ign_A, 3osg_A, 1vfc_A, 2kdz_A, 7xur_A, 5eyb_B, 6kks_A, 7c4r_A, 1mse_C, 3zqc_A |
| Binding Motifs: | MYB44 GTyAGTTAsG M0498 dwdwCvGTTwwwwCvGTTr M0554 wwTAACcGwww MA2027.1 wtAACGGTcAww MA2027.2 tAACGGTcA |
| Binding Sites: | MYB44_1 MYB44_2 MA2027.1.5 MA2027.1.3 / MA2027.1.6 MA2027.1.1 MA2027.1.2 MA2027.1.7 MA2027.1.8 MA2027.1.10 MA2027.1.11 MA2027.1.12 / MA2027.1.13 MA2027.1.14 MA2027.1.15 MA2027.1.16 MA2027.1.17 MA2027.1.18 MA2027.1.19 MA2027.1.20 MA2027.1.4 MA2027.1.9 MA2027.2.1 / MA2027.2.19 MA2027.2.10 / MA2027.2.17 MA2027.2.11 MA2027.2.12 / MA2027.2.13 / MA2027.2.14 MA2027.2.15 MA2027.2.16 / MA2027.2.5 MA2027.2.18 / MA2027.2.8 MA2027.2.2 MA2027.2.20 / MA2027.2.9 MA2027.2.3 / MA2027.2.6 / MA2027.2.7 MA2027.2.4 |
| Publications: | Kirik V., Kolle K., Misera S., Baeumlein H. Two novel MYB homologues with changed expression in late embryogenesis-defective Arabidopsis mutants. Plant Mol. Biol. 37:819-827 (1998). [Pubmed] Sullivan AM, Arsovski AA, Lempe J, Bubb KL, Weirauch MT, Sabo PJ, Sandstrom R, Thurman RE, Neph S, Reynolds AP, Stergachis AB, Vernot B, Johnson AK, Haugen E, Sullivan ST, Thompson A, Neri FV 3rd, Weaver M, Diegel M, Mnaimneh S, Yang A, Hughes TR, Nemhauser JL, Queitsch C, Stamatoyannopoulos JA. Mapping and dynamics of regulatory DNA and transcription factor networks in A. thaliana 8:2015-2030 (Cell). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.