Transcription Factor
| Accessions: | IRF8_DBD (HumanTF 1.0), IRF8 (HT-SELEX2 May2017) |
| Names: | H-ICSBP, Interferon consensus sequence-binding protein, Interferon regulatory factor 8, IRF-8, IRF8, IRF8_HUMAN, ENSG00000140968 |
| Organisms: | Homo sapiens |
| Libraries: | HumanTF 1.0 1, HT-SELEX2 May2017 2 1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] 2 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
| Uniprot: | Q02556 |
| Notes: | Ensembl ID: ENSG00000140968; DNA-binding domain sequence; TF family: IRF; Clone source: Gene synthesis, TF family: IRF experiment: HT-SELEX Hamming distance: 1 cycle: 3, TF family: IRF experiment: HT-SELEX Hamming distance: 1 cycle: 4, TF family: IRF experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 3, TF family: IRF experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 4 |
| Length: | 132 |
| Pfam Domains: | 8-113 Interferon regulatory factor transcription factor |
| Sequence: (in bold interface residues) | 1 CDRNGGRRLRQWLIEQIDSSMYPGLIWENEEKSMFRIPWKHAGKQDYNQEVDASIFKAWA 60 61 VFKGKFKEGDKAEPATWKTRLRCALNKSPDFEEVTDRSQLDISEPYKVYRIVPEEEQKCK 120 121 LGVATAGCVNEV |
| Interface Residues: | 41, 43, 75, 79, 80, 82, 83, 86, 87 |
| 3D-footprint Homologues: | 2pi0_B, 1if1_B, 2o61_A, 2irf_L, 7oot_B |
| Binding Motifs: | IRF8_DBD wCGAAACYGAAACy IRF8_2 acGAAAsyGAAACyr IRF8_4 wCGAAACyGAAACyr IRF8_methyl_1 ryGAAAsyGAAAsyr IRF8_methyl_3 ryGAAAsyGAAACyr |
| Publications: | Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.