Transcription Factor

						

			
Accessions: 4yj0_B (3D-footprint 20231221), 4yj0_C (3D-footprint 20231221)

			
Names: DM domain expressed in testis protein 1, DMRT1_HUMAN, Doublesex- and mab-3-related transcription factor 1
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q9Y5R6
Length: 63
Pfam Domains:      4-50 DM DNA binding domain
Sequence: 
(in bold interface residues)		   1 KSPRLPKCARCRNHGYASPLKGHKRFCMWRDCQCKKCNLIAERQRVMAAQVALRRQQAQE   60
  61 EEL
Interface Residues: 4, 43, 47, 50, 51, 54, 55
3D-footprint Homologues: 4yj0_C
Binding Motifs: 4yj0_ABC ATACAnTGTTG
4yj0_C TGTTG
Binding Sites: 4yj0_D
4yj0_E
			
Publications: Murphy MW, Lee JK, Rojo S, Gearhart MD, Kurahashi K, Banerjee S, Loeuille GA, Bashamboo A, McElreavey K, Zarkower D, Aihara H, Bardwell VJ. An ancient protein-DNA interaction underlying metazoan sex determination. Nat Struct Mol Biol 22:442-51 (2015). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.