Transcription Factor

Accessions: HOXC8 (HT-SELEX2 May2017), P31273 (JASPAR 2024)
Names: ENSG00000037965, HOXC8, Homeobox protein Hox-3A, Homeobox protein Hox-C8, HXC8_HUMAN
Organisms: Homo sapiens
Libraries: HT-SELEX2 May2017 1, JASPAR 2024 2
1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Uniprot: P31273
Notes: TF family: Homeodomain experiment: HT-SELEX Hamming distance: 1 cycle: 3, TF family: Homeodomain experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 3
Length: 242
Pfam Domains: 150-206 Homeobox domain
Sequence:
(in bold interface residues)
1 MSSYFVNPLFSKYKAGESLEPAYYDCRFPQSVGRSHALVYGPGGSAPGFQHASHHVQDFF 60
61 HHGTSGISNSGYQQNPCSLSCHGDASKFYGYEALPRQSLYGAQQEASVVQYPDCKSSANT 120
121 NSSEGQGHLNQNSSPSLMFPWMRPHAPGRRSGRQTYSRYQTLELEKEFLFNPYLTRKRRI 180
181 EVSHALGLTERQVKIWFQNRRMKWKKENNKDKLPGARDEEKVEEEGNEEEEKEEEEKEEN 240
241 KD
Interface Residues: 130, 149, 150, 151, 152, 153, 154, 191, 192, 194, 195, 198, 199, 201, 202, 203, 206, 216, 219
3D-footprint Homologues: 1e3o_C, 5zfz_A, 8ejp_B, 6a8r_A, 1fjl_B, 3cmy_A, 8pmf_A, 1puf_A, 1ig7_A, 1nk2_P, 1zq3_P, 2lkx_A, 3d1n_M, 2ld5_A, 5zjt_E, 1puf_B, 8ik5_C, 1jgg_B, 7psx_B, 5hod_A, 3lnq_A, 3a01_E, 8osb_E, 7q3o_C, 5jlw_D, 3rkq_B, 8eml_B, 6es3_K, 4xrs_G, 2hdd_A, 1b72_A, 4cyc_A, 2r5y_A, 6m3d_C, 5flv_I, 2hos_A, 9b8u_A, 2xsd_C, 1le8_A, 7xrc_C, 1du0_A, 4qtr_D, 4xrm_B, 1k61_B, 1o4x_A, 8g87_X, 1mnm_C, 8bx1_A
Binding Motifs: HOXC8_3 / MA1505.1 gyAATTRc
HOXC8_methyl_1 rtCrTTAw
HOXC8_methyl_2 gyaATtrc
MA1505.2 yAATTR
Publications: Berger M.F, Badis G, Gehrke A.R, Talukder S, Philippakis A.A, Peña-Castillo L, Alleyne T.M, Mnaimneh S, Botvinnik O.B, Chan E.T, Khalid F, Zhang W, Newburger D, Jaeger S.A, Morris Q.D, Bulyk M.L, Hughes T.R. Variation in homeodomain DNA binding revealed by high-resolution analysis of sequence preferences. Cell 133:1266-76 (2008). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.