Transcription Factor

Accessions: 1mhd_A (3D-footprint 20231221), 1mhd_B (3D-footprint 20231221)
Names: hMAD-3, hSMAD3, JV15-2, MAD homolog 3, Mothers against decapentaplegic homolog 3, Mothers against DPP homolog 3, SMAD 3, SMAD family member 3, SMAD3_HUMAN
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P84022
Length: 123
Pfam Domains: 22-122 MH1 domain
Sequence:
(in bold interface residues)
1 PIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPR 60
61 SLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQR 120
121 VET
Interface Residues: 22, 24, 28, 63, 65, 67, 70, 72
3D-footprint Homologues: 8cli_A, 6fzs_A, 6h3r_A, 5nm9_A, 5od6_A, 5mey_A, 2qnf_A
Binding Motifs: 1mhd_AB TGTCTATACT
1mhd_B TAGACT
Binding Sites: 1mhd_C
1mhd_D
Publications: Shi Y., Wang Y. F., Jayaraman L., Yang H., Massague J., Pavletich N. P. Crystal structure of a Smad MH1 domain bound to DNA: insights on DNA binding in TGF-beta signaling. Cell 94:585-594 (1998). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.