Transcription Factor
| Accessions: | 1cit_A (3D-footprint 20231221) |
| Names: | Nerve growth factor-induced protein I-B, NR4A1_RAT, Nuclear receptor subfamily 4 group A member 1, NUR77, Orphan nuclear receptor HMR, ORPHAN NUCLEAR RECEPTOR NGFI-B |
| Organisms: | Rattus norvegicus |
| Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P22829 |
| Length: | 89 |
| Pfam Domains: | 2-70 Zinc finger, C4 type (two domains) |
| Sequence: (in bold interface residues) | 1 GRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKSAKYICLANKDCPVDKRRRNRCQFCRF 60 61 QKCLAVGMVKEVVRTDSLKGRRGRLPSKP |
| Interface Residues: | 11, 12, 14, 15, 21, 22, 24, 25, 28, 29, 33, 34, 37, 53, 79, 82, 84 |
| 3D-footprint Homologues: | 6fbq_A, 6l6q_B, 7wnh_D, 1lo1_A, 3g9m_B, 1a6y_A, 4oln_B, 3cbb_A, 7xv6_B, 4iqr_B, 2han_A, 1hcq_E, 4umm_E, 8cef_H, 2han_B, 1kb2_B, 2a66_A, 8hbm_B, 5krb_G, 2nll_B, 1lat_A, 2ff0_A, 1dsz_A, 4tnt_B, 5e69_A, 3g6t_A, 1r4i_A, 5emc_A, 7prw_B, 5cbx_B, 5cbz_E, 4hn5_B, 4rul_A |
| Binding Motifs: | 1cit_A TGACCTnTT |
| Binding Sites: | 1cit_B 1cit_C |
| Publications: | Meinke G, Sigler P.B. DNA-binding mechanism of the monomeric orphan nuclear receptor NGFI-B. Nature structural biology 6:471-7 (1999). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.