Transcription Factor

Accessions: 1cit_A (3D-footprint 20241219)
Names: Nerve growth factor-induced protein I-B, NR4A1_RAT, Nuclear receptor subfamily 4 group A member 1, NUR77, Orphan nuclear receptor HMR, ORPHAN NUCLEAR RECEPTOR NGFI-B
Organisms: Rattus norvegicus
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P22829
Length: 89
Pfam Domains: 2-70 Zinc finger, C4 type (two domains)
Sequence:
(in bold interface residues)
1 GRCAVCGDNASCQHYGVRTCEGCKGFFKRTVQKSAKYICLANKDCPVDKRRRNRCQFCRF 60
61 QKCLAVGMVKEVVRTDSLKGRRGRLPSKP
Interface Residues: 12, 14, 21, 24, 25, 28, 29, 53, 79, 82, 84
3D-footprint Homologues: 6l6q_B, 7wnh_D, 3g9m_B, 2han_A, 7xvn_C, 2han_B, 8cef_H, 2a66_A, 2nll_B, 8hbm_B, 2ff0_A, 7xv6_B, 8rm6_A, 7prw_B, 5cbx_B, 5cbz_E, 3g6t_A
Binding Motifs: 1cit_A TGACCTnTT
Binding Sites: 1cit_B
1cit_C
Publications: Meinke G, Sigler P.B. DNA-binding mechanism of the monomeric orphan nuclear receptor NGFI-B. Nature structural biology 6:471-7 (1999). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.