Transcription Factor
| Accessions: | HOXD4 (HT-SELEX2 May2017) |
| Names: | ENSG00000170166, HOXD4 |
| Organisms: | Homo sapiens |
| Libraries: | HT-SELEX2 May2017 1 1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] |
| Notes: | TF family: Homeodomain experiment: HT-SELEX Hamming distance: 1 cycle: 2, TF family: Homeodomain experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 2 |
| Length: | 131 |
| Pfam Domains: | 43-99 Homeobox domain |
| Sequence: (in bold interface residues) | 1 YSQSDPKQPPSGTALKQPAVVYPWMKKVHVNSVNPNYTGGEPKRSRTAYTRQQVLELEKE 60 61 FHFNRYLTRRRRIEIAHTLCLSERQIKIWFQNRRMKWKKDHKLPNTKGRSSSSSSSSSCS 120 121 SSVAPSQHLQP |
| Interface Residues: | 43, 44, 45, 46, 84, 85, 87, 88, 91, 92, 95, 96, 99 |
| 3D-footprint Homologues: | 1puf_A, 3cmy_A, 5zfz_A, 1fjl_B, 3d1n_M, 6a8r_A, 2h1k_B, 1jgg_B, 3lnq_A, 2lkx_A, 6m3d_C, 1nk2_P, 1zq3_P, 2ld5_A, 7q3o_C, 5jlw_D, 6es3_K, 4xrs_G, 2hdd_A, 3rkq_B, 2r5y_A, 5flv_I, 2hos_A, 1b72_A, 5zjt_E, 4cyc_A, 1ig7_A, 7psx_B, 5hod_A, 3a01_E, 1e3o_C, 1le8_A, 7xrc_C, 2xsd_C, 1puf_B, 8g87_X, 3l1p_A, 1o4x_A, 1du0_A, 4qtr_D |
| Binding Motifs: | HOXD4_3 kymATKAs HOXD4_6 rYmATTAr HOXD4_methyl_1 bymATkAs HOXD4_methyl_2 rTCrTTAr HOXD4_methyl_4 rymATTAr HOXD4_methyl_5 rTCrTTAr |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.