Transcription Factor
| Accessions: | 6ncm_A (3D-footprint 20231221) |
| Names: | Checkpoint suppressor 1, Forkhead box protein N3, FOXN3_HUMAN |
| Organisms: | Homo sapiens |
| Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | O00409 |
| Length: | 91 |
| Pfam Domains: | 2-83 Fork head domain |
| Sequence: (in bold interface residues) | 1 CKPPYSFSCLIFMAIEDSPTKRLPVKDIYNWILEHFPYFANAPTGWKNSVRHNLSLNKCF 60 61 KKVDKKGSLWCIDPEYRQNLIQALKKTPYHP |
| Interface Residues: | 42, 45, 47, 48, 49, 51, 52, 53, 55, 56, 65, 66 |
| 3D-footprint Homologues: | 3l2c_A, 7vox_H, 2hdc_A, 6ako_C, 2c6y_A, 7yzg_A, 7tdw_A, 3g73_A, 7yz7_A, 6el8_A, 7tdx_A, 7yzb_A, 6nce_A, 2uzk_A, 7vou_C, 2a07_J, 7yze_A, 7cby_C, 3co6_C, 3qrf_G |
| Binding Motifs: | 6ncm_AB TAGCGta |
| Publications: | Rogers JM, Waters CT, Seegar TCM, Jarrett SM, Hallworth AN, Blacklow SC, Bulyk ML. Bispecific Forkhead Transcription Factor FoxN3 Recognizes Two Distinct Motifs with Different DNA Shapes. Mol Cell 74:245-253 (2019). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.