Transcription Factor

Accessions: 6ht5_E (3D-footprint 20260701)
Names: NF-A3, Oct-3, Oct-4, Octamer-binding protein 3, Octamer-binding protein 4, Octamer-binding transcription factor 3, OTF-3, PO5F1_MOUSE, POU domain, class 5, transcription factor 1
Organisms: Mus musculus
Libraries: 3D-footprint 20260701 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P20263
Length: 101
Pfam Domains: 5-77 Pou domain - N-terminal to homeobox domain
Sequence:
(in bold interface residues)
1 GADMKALQKELEQFAKLLKQKRITLGYTQADVGLTLGVLFGKVFSQTTISRFEALQLSLK 60
61 NMSKLRPLLEKWVEEADNNENLQEISKSETLVQARKRKRTS
Interface Residues: 9, 29, 30, 45, 46, 47, 48, 50, 51, 57, 61, 97
3D-footprint Homologues: 2xkk_C, 3d1n_M, 8bx1_A, 7u0g_M, 4z5h_A, 1o4x_A, 8g87_X, 1au7_A, 2xsd_C, 7xrc_C, 1e3o_C
Binding Motifs: 6ht5_DE CATTGTTATGC
6ht5_E tATgC
Binding Sites: 6ht5_A
6ht5_B
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.