Transcription Factor
| Accessions: | CG2052 (FlyZincFinger 1.0 ) |
| Names: | CG2052 |
| Organisms: | Drosophila melanogaster |
| Libraries: | FlyZincFinger 1.0 1 1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed] |
| Notes: | family:Cys2His2 zinc finger |
| Length: | 289 |
| Pfam Domains: | 4-27 C2H2-type zinc finger 5-27 Zinc finger, C2H2 type 5-27 C2H2-type zinc finger 20-44 Zinc-finger double domain 32-43 C2H2-type zinc finger 33-55 Zinc finger, C2H2 type 33-53 C2H2-type zinc finger 48-72 Zinc-finger double domain 61-85 C2H2-type zinc finger 61-85 Zinc finger, C2H2 type 67-85 C2H2-type zinc finger 77-108 Zinc-finger double domain 97-115 C2H2-type zinc finger 97-115 C2H2-type zinc finger 97-116 Zinc-finger of C2H2 type 97-118 Zinc finger, C2H2 type 139-168 C2H2 type zinc-finger (2 copies) 142-164 C2H2-type zinc finger 142-163 C2H2-type zinc finger 231-253 C2H2-type zinc finger 231-253 C2H2-type zinc finger 266-287 Zinc-finger of C2H2 type 266-287 C2H2-type zinc finger 268-286 C2H2-type zinc finger |
| Sequence: (in bold interface residues) | 1 DTKPHQCQQCMKSFSSNHQLVQHIRVHTGEKPYKCSYCDRRFKQLSHVQQHTRLHTGERP 60 61 YKCHLPDCGRAFIQLSNLQQHLRNHDAQVERAKNRPFHCNICGKGFATESSLRTHTSKEL 120 121 QLHLGVLQQHAALIGGPNATSCPVCHKLFLGTEALVDHMKHVHKEKSPPPGGSASSQFSE 180 181 LNQIVTGNGNGTGSSNEQIATQCTTESNSHQATVGSSLIDSFLGKRRTANHPCPVCGKHY 240 241 VNEGSLRKHLACHAENSQLTNSLRMWPCSVCQAVFTHENGLLTHMESMR |
| Interface Residues: | 15, 16, 17, 18, 19, 21, 22, 26, 43, 44, 45, 46, 47, 49, 50, 51, 52, 53, 56, 73, 74, 75, 76, 77, 78, 79, 80, 81, 84, 107, 108, 109, 110, 111, 113, 114, 118, 120, 121, 124, 129, 150, 151, 152, 153, 154, 157, 160, 180, 183, 186, 189, 203, 204, 205, 206, 207, 208, 209, 223, 241, 242, 243, 245, 277, 279, 280, 283 |
| 3D-footprint Homologues: | 1tf3_A, 7y3l_A, 7n5w_A, 6jnm_A, 3uk3_C, 5k5i_A, 2kmk_A, 1llm_D, 7ysf_A, 8ssq_A, 7w1m_H, 4x9j_A, 2gli_A, 8ssu_A, 1f2i_J, 5kkq_D, 8gn3_A, 5ei9_F, 5kl3_A, 1ubd_C, 8h9h_G, 2lt7_A, 6e94_A, 1tf6_A, 6a57_A, 8cuc_F, 6ml4_A, 5v3j_F, 2drp_D, 6blw_A, 6u9q_A, 5yel_A, 2wbs_A, 5yj3_D, 1g2f_F, 7txc_E, 4m9v_C, 7y3m_I, 2jpa_A, 5k5l_F |
| Binding Motifs: | CG2052_SANGER_2.5_FBgn0039905 aarrbyAAAAAAAt CG2052_SOLEXA_2.5_FBgn0039905 mmmmarAAAAAAwsm |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.