Transcription Factor

Accessions: CG2052 (FlyZincFinger 1.0 )
Names: CG2052
Organisms: Drosophila melanogaster
Libraries: FlyZincFinger 1.0 1
1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed]
Notes: family:Cys2His2 zinc finger
Length: 289
Pfam Domains: 4-27 C2H2-type zinc finger
5-27 Zinc finger, C2H2 type
5-27 C2H2-type zinc finger
20-44 Zinc-finger double domain
32-43 C2H2-type zinc finger
33-55 Zinc finger, C2H2 type
33-53 C2H2-type zinc finger
48-72 Zinc-finger double domain
61-85 C2H2-type zinc finger
61-85 Zinc finger, C2H2 type
67-85 C2H2-type zinc finger
77-108 Zinc-finger double domain
97-115 C2H2-type zinc finger
97-115 C2H2-type zinc finger
97-116 Zinc-finger of C2H2 type
97-118 Zinc finger, C2H2 type
139-168 C2H2 type zinc-finger (2 copies)
142-164 C2H2-type zinc finger
142-163 C2H2-type zinc finger
231-253 C2H2-type zinc finger
231-253 C2H2-type zinc finger
266-287 Zinc-finger of C2H2 type
266-287 C2H2-type zinc finger
268-286 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 DTKPHQCQQCMKSFSSNHQLVQHIRVHTGEKPYKCSYCDRRFKQLSHVQQHTRLHTGERP 60
61 YKCHLPDCGRAFIQLSNLQQHLRNHDAQVERAKNRPFHCNICGKGFATESSLRTHTSKEL 120
121 QLHLGVLQQHAALIGGPNATSCPVCHKLFLGTEALVDHMKHVHKEKSPPPGGSASSQFSE 180
181 LNQIVTGNGNGTGSSNEQIATQCTTESNSHQATVGSSLIDSFLGKRRTANHPCPVCGKHY 240
241 VNEGSLRKHLACHAENSQLTNSLRMWPCSVCQAVFTHENGLLTHMESMR
Interface Residues: 15, 16, 17, 18, 19, 21, 22, 26, 43, 44, 45, 46, 47, 49, 50, 51, 52, 53, 56, 73, 74, 75, 76, 77, 78, 79, 80, 81, 84, 107, 108, 109, 110, 111, 113, 114, 118, 120, 121, 124, 129, 150, 151, 152, 153, 154, 157, 160, 180, 183, 186, 189, 203, 204, 205, 206, 207, 208, 209, 223, 241, 242, 243, 245, 277, 279, 280, 283
3D-footprint Homologues: 1tf3_A, 7y3l_A, 7n5w_A, 6jnm_A, 3uk3_C, 5k5i_A, 2kmk_A, 1llm_D, 7ysf_A, 8ssq_A, 7w1m_H, 4x9j_A, 2gli_A, 8ssu_A, 1f2i_J, 5kkq_D, 8gn3_A, 5ei9_F, 5kl3_A, 1ubd_C, 8h9h_G, 2lt7_A, 6e94_A, 1tf6_A, 6a57_A, 8cuc_F, 6ml4_A, 5v3j_F, 2drp_D, 6blw_A, 6u9q_A, 5yel_A, 2wbs_A, 5yj3_D, 1g2f_F, 7txc_E, 4m9v_C, 7y3m_I, 2jpa_A, 5k5l_F
Binding Motifs: CG2052_SANGER_2.5_FBgn0039905 aarrbyAAAAAAAt
CG2052_SOLEXA_2.5_FBgn0039905 mmmmarAAAAAAwsm
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.