Transcription Factor

Accessions: Cf2-PB (FlyZincFinger 1.0 )
Names: CG11924
Organisms: Drosophila melanogaster
Libraries: FlyZincFinger 1.0 1
1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed]
Notes: family:Cys2His2 zinc finger
Length: 268
Pfam Domains: 4-14 C2H2-type zinc finger
4-26 Zinc finger, C2H2 type
4-26 C2H2-type zinc finger
19-50 Zinc-finger double domain
38-55 C2H2-type zinc finger
39-58 C2H2-type zinc finger
39-61 Zinc finger, C2H2 type
54-77 Zinc-finger double domain
67-89 C2H2-type zinc finger
67-76 C2H2-type zinc finger
67-89 Zinc finger, C2H2 type
68-86 zinc-finger of a C2HC-type
82-105 Zinc-finger double domain
95-117 Zinc finger, C2H2 type
95-117 C2H2-type zinc finger
95-105 C2H2-type zinc finger
110-134 Zinc-finger double domain
122-142 C2H2-type zinc finger
123-146 Zinc finger, C2H2 type
123-146 C2H2-type zinc finger
125-207 C2H2 type zinc-finger (2 copies)
138-163 Zinc-finger double domain
152-174 Zinc finger, C2H2 type
152-174 C2H2-type zinc finger
152-162 C2H2-type zinc finger
167-198 Zinc-finger double domain
186-203 C2H2-type zinc finger
187-209 Zinc finger, C2H2 type
187-206 C2H2-type zinc finger
202-225 Zinc-finger double domain
215-237 Zinc finger, C2H2 type
215-237 C2H2-type zinc finger
215-225 C2H2-type zinc finger
230-254 Zinc-finger double domain
242-262 C2H2-type zinc finger
243-266 Zinc finger, C2H2 type
243-266 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 KIRHKCPDCPKTFKTPGTLAMHRKIHTGEADATPKERPYTCSYCGKSFTQSNTLKQHTRI 60
61 HTGEKPFRCGYCGRAFTVKDYLNKHLTTHTGEKPFHCGYCEKSFSVKDYLTKHIRTHTGE 120
121 KPYTCPYCDKRFTQRSALTVHTTKLHPLKIRHKCPDCPKTFKTPGTLAMHRKIHTGEADA 180
181 TPKERPYTCSYCGKSFTQSNTLKQHTRIHTGEKPFHCGYCEKSFSVKDYLTKHIRTHTGE 240
241 KPYTCPYCDKRFTQRSALTVHTTKLHPL
Interface Residues: 14, 15, 16, 18, 21, 25, 39, 49, 50, 51, 52, 53, 55, 56, 57, 58, 59, 60, 62, 77, 78, 79, 80, 81, 82, 83, 84, 85, 105, 106, 107, 108, 109, 112, 133, 134, 135, 136, 137, 139, 140, 144, 163, 164, 165, 166, 169, 171, 197, 198, 199, 200, 201, 203, 204, 210, 224, 226, 227, 228, 229, 232, 236, 253, 254, 255, 256, 257, 258, 259, 260, 264
3D-footprint Homologues: 7w1m_H, 7n5w_A, 5kkq_D, 8h9h_G, 2kmk_A, 8cuc_F, 7y3l_A, 1g2f_F, 5kl3_A, 8gn3_A, 5v3j_F, 6blw_A, 2gli_A, 8ssq_A, 5ei9_F, 8ssu_A, 4m9v_C, 7ysf_A, 6e94_A, 2jpa_A, 7txc_E, 6ml4_A, 2drp_D, 2wbs_A, 1tf6_A, 5yj3_D, 3uk3_C, 1llm_D, 7y3m_I, 5k5i_A, 5k5l_F, 8gh6_A, 5yel_A, 1ubd_C, 6jnm_A, 1tf3_A, 6u9q_A, 4x9j_A, 1f2i_J, 2lt7_A, 6a57_A
Binding Motifs: Cf2-PA_SANGER_2.5_FBgn0000286 TAdsyGAAA
Cf2-PA_SOLEXA_FBgn0000286 aYmTAgTATa
Cf2-PB_SANGER_5_FBgn0000286 CsshbkdTAcrTATw
Cf2-PB_SOLEXA_FBgn0000286 mTATAtryAmm
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.