Transcription Factor
Accessions: | Cf2-PB (FlyZincFinger 1.0 ) |
Names: | CG11924 |
Organisms: | Drosophila melanogaster |
Libraries: | FlyZincFinger 1.0 1 1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed] |
Notes: | family:Cys2His2 zinc finger |
Length: | 268 |
Pfam Domains: | 4-14 C2H2-type zinc finger 4-26 Zinc finger, C2H2 type 4-26 C2H2-type zinc finger 19-50 Zinc-finger double domain 38-55 C2H2-type zinc finger 39-58 C2H2-type zinc finger 39-61 Zinc finger, C2H2 type 54-77 Zinc-finger double domain 67-89 C2H2-type zinc finger 67-76 C2H2-type zinc finger 67-89 Zinc finger, C2H2 type 68-86 zinc-finger of a C2HC-type 82-105 Zinc-finger double domain 95-117 Zinc finger, C2H2 type 95-117 C2H2-type zinc finger 95-105 C2H2-type zinc finger 110-134 Zinc-finger double domain 122-142 C2H2-type zinc finger 123-146 Zinc finger, C2H2 type 123-146 C2H2-type zinc finger 125-207 C2H2 type zinc-finger (2 copies) 138-163 Zinc-finger double domain 152-174 Zinc finger, C2H2 type 152-174 C2H2-type zinc finger 152-162 C2H2-type zinc finger 167-198 Zinc-finger double domain 186-203 C2H2-type zinc finger 187-209 Zinc finger, C2H2 type 187-206 C2H2-type zinc finger 202-225 Zinc-finger double domain 215-237 Zinc finger, C2H2 type 215-237 C2H2-type zinc finger 215-225 C2H2-type zinc finger 230-254 Zinc-finger double domain 242-262 C2H2-type zinc finger 243-266 Zinc finger, C2H2 type 243-266 C2H2-type zinc finger |
Sequence: (in bold interface residues) | 1 KIRHKCPDCPKTFKTPGTLAMHRKIHTGEADATPKERPYTCSYCGKSFTQSNTLKQHTRI 60 61 HTGEKPFRCGYCGRAFTVKDYLNKHLTTHTGEKPFHCGYCEKSFSVKDYLTKHIRTHTGE 120 121 KPYTCPYCDKRFTQRSALTVHTTKLHPLKIRHKCPDCPKTFKTPGTLAMHRKIHTGEADA 180 181 TPKERPYTCSYCGKSFTQSNTLKQHTRIHTGEKPFHCGYCEKSFSVKDYLTKHIRTHTGE 240 241 KPYTCPYCDKRFTQRSALTVHTTKLHPL |
Interface Residues: | 14, 15, 16, 17, 18, 21, 25, 36, 39, 49, 50, 51, 52, 53, 55, 56, 57, 58, 59, 60, 62, 77, 78, 79, 80, 81, 82, 83, 84, 85, 105, 106, 107, 108, 109, 112, 133, 134, 135, 136, 137, 139, 140, 144, 163, 164, 165, 166, 169, 171, 197, 198, 199, 200, 201, 203, 204, 210, 224, 226, 227, 228, 229, 232, 236, 253, 254, 255, 256, 257, 258, 259, 260, 264 |
3D-footprint Homologues: | 7w1m_H, 7n5w_A, 5kkq_D, 6wmi_A, 8h9h_G, 7eyi_G, 1yuj_A, 2kmk_A, 8cuc_F, 7y3l_A, 2gli_A, 8ssq_A, 5v3j_F, 1mey_C, 6blw_A, 8ssu_A, 5ei9_F, 8gn3_A, 5kl3_A, 1g2f_F, 4m9v_C, 6e94_A, 7ysf_A, 2jpa_A, 1tf6_A, 5und_A, 6ml4_A, 2wbs_A, 7txc_E, 2drp_D, 5yj3_D, 3uk3_C, 1llm_D, 2i13_A, 5k5i_A, 7y3m_I, 5k5l_F, 8gh6_A, 5yel_A, 1ubd_C, 6jnm_A, 1tf3_A, 4x9j_A, 1f2i_J, 6u9q_A, 2lt7_A, 6a57_A |
Binding Motifs: | Cf2-PA_SANGER_2.5_FBgn0000286 TAdsyGAAA Cf2-PA_SOLEXA_FBgn0000286 aYmTAgTATa Cf2-PB_SANGER_5_FBgn0000286 CsshbkdTAcrTATw Cf2-PB_SOLEXA_FBgn0000286 mTATAtryAmm |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.