Transcription Factor
| Accessions: | 1mj2_A (3D-footprint 20231221), 1mj2_B (3D-footprint 20231221), 1mj2_C (3D-footprint 20231221), 1mj2_D (3D-footprint 20231221), 1mjm_A (3D-footprint 20231221), 1mjm_B (3D-footprint 20231221), 1mjo_A (3D-footprint 20231221), 1mjo_B (3D-footprint 20231221), 1mjo_C (3D-footprint 20231221), 1mjo_D (3D-footprint 20231221), 1mjp_A (3D-footprint 20231221), 1mjp_B (3D-footprint 20231221), 1mjq_A (3D-footprint 20231221), 1mjq_B (3D-footprint 20231221), 1mjq_C (3D-footprint 20231221), 1mjq_D (3D-footprint 20231221), 1mjq_G (3D-footprint 20231221), 1mjq_H (3D-footprint 20231221), 1mjq_I (3D-footprint 20231221), 1mjq_J (3D-footprint 20231221) |
| Names: | Met regulon regulatory protein MetJ, Met repressor, METHIONINE REPRESSOR, METJ_ECOLI |
| Organisms: | Escherichia coli, strain K12 |
| Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P0A8U6 |
| Length: | 104 |
| Pfam Domains: | 1-104 Met Apo-repressor, MetJ |
| Sequence: (in bold interface residues) | 1 AEWSGEYISPYAEHGKKSEQVKKITVSIPLKVLKILTDERTRRKVNNLRHATNSELLCEA 60 61 FLHAFTGQPLPDDADLRKERSDEIPEAAKEIMREMGINPETWEY |
| Interface Residues: | 2, 3, 7, 8, 23, 25, 42, 66 |
| 3D-footprint Homologues: | 6crm_A, 1mjo_B, 6mrj_D, 1zgw_A |
| Binding Motifs: | 1mj2_ABCD AGACGTCyAGAnGACy 1mj2_B mGnnkT 1mjm_AB rGACGTC 1mjm_B GAcnnCT 1mjo_ABCD rGACGTCaTGACGACT 1mjo_B GGmnGTy 1mjp_AB rGACsnC 1mjq_A AGnnAt 1mjq_ABCD AGTTATCTrGATAwCT 1mjq_GHIJ AGnTATCYwGAtAwCT |
| Binding Sites: | 1mjp_C 1mjp_D 1mj2_F / 1mj2_G 1mjm_C / 1mjm_D 1mjo_F / 1mjo_G 1mjq_E / 1mjq_F / 1mjq_K / 1mjq_L |
| Publications: | Garvie C.W, Phillips S.E. Direct and indirect readout in mutant Met repressor-operator complexes. Structure (London, England : 1993) 8:905-14 (2000). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.