Transcription Factor
| Accessions: | 6b0r_D (3D-footprint 20250804) |
| Names: | Wilms tumor protein, WT1_HUMAN, WT33 |
| Organisms: | Homo sapiens |
| Libraries: | 3D-footprint 20250804 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Length: | 117 |
| Pfam Domains: | 6-28 C2H2-type zinc finger 20-47 Zinc-finger double domain 34-58 C2H2-type zinc finger 34-58 Zinc finger, C2H2 type 51-75 Zinc-finger double domain 64-86 C2H2-type zinc finger 64-86 Zinc finger, C2H2 type 78-104 Zinc-finger double domain 92-116 Zinc finger, C2H2 type 92-114 C2H2-type zinc finger |
| Sequence: (in bold interface residues) | 1 MRPFMCAYPGCNKRYFKLSHLQRHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTG 60 61 VKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQ |
| Interface Residues: | 16, 17, 18, 19, 20, 22, 23, 25, 26, 29, 46, 47, 48, 49, 50, 52, 53, 57, 74, 75, 76, 77, 78, 79, 80, 81, 82, 104, 105, 106, 107, 108, 109, 110, 111, 112 |
| 3D-footprint Homologues: | 3uk3_C, 7n5w_A, 6jnm_A, 5ei9_F, 6ml4_A, 5v3j_F, 8ssq_A, 7w1m_H, 6blw_A, 5k5i_A, 2kmk_A, 6u9q_A, 8ssu_A, 5kkq_D, 2gli_A, 8h9h_G, 7ysf_A, 6e94_A, 2lt7_A, 1tf6_A, 2jpa_A, 1ubd_C, 8cuc_F, 7y3l_A, 1tf3_A, 7txc_E, 1g2f_F, 5yel_A, 2drp_D, 4x9j_A, 1f2i_J, 5kl3_A, 2wbs_A, 7y3m_I, 6a57_A, 8gn3_A, 1llm_D, 5yj3_D, 4m9v_C |
| Binding Motifs: | 6b0r_D GCGTGGGAGGGtt |
| Binding Sites: | 6b0r_E 6b0r_F |
| Publications: | Wang D, Horton JR, Zheng Y, Blumenthal RM, Zhang X, Cheng X. Role for first zinc finger of WT1 in DNA sequence specificity: Denys-Drash syndrome-associated WT1 mutant in ZF1 enhances affinity for a subset of WT1 binding sites. Nucleic Acids Res 46:3864-3877 (2018). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.