Transcription Factor

Accessions: 6b0r_D (3D-footprint 20250804)
Names: Wilms tumor protein, WT1_HUMAN, WT33
Organisms: Homo sapiens
Libraries: 3D-footprint 20250804 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Length: 117
Pfam Domains: 6-28 C2H2-type zinc finger
20-47 Zinc-finger double domain
34-58 C2H2-type zinc finger
34-58 Zinc finger, C2H2 type
51-75 Zinc-finger double domain
64-86 C2H2-type zinc finger
64-86 Zinc finger, C2H2 type
78-104 Zinc-finger double domain
92-114 C2H2-type zinc finger
92-116 Zinc finger, C2H2 type
Sequence:
(in bold interface residues)
1 MRPFMCAYPGCNKRYFKLSHLQRHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTG 60
61 VKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQ
Interface Residues: 16, 17, 18, 19, 20, 22, 23, 25, 26, 29, 46, 47, 48, 49, 50, 52, 53, 57, 74, 75, 76, 77, 78, 79, 80, 81, 82, 104, 105, 106, 107, 108, 109, 110, 111, 112
3D-footprint Homologues: 7n5w_A, 6jnm_A, 3uk3_C, 5ei9_F, 6ml4_A, 5v3j_F, 8ssq_A, 7w1m_H, 6blw_A, 5k5i_A, 2kmk_A, 6u9q_A, 8ssu_A, 5kkq_D, 2gli_A, 8h9h_G, 1tf6_A, 7ysf_A, 6e94_A, 2lt7_A, 2jpa_A, 1ubd_C, 1tf3_A, 8cuc_F, 7y3l_A, 4x9j_A, 1f2i_J, 5kl3_A, 2wbs_A, 7txc_E, 1g2f_F, 5yel_A, 2drp_D, 7y3m_I, 6a57_A, 8gn3_A, 5yj3_D, 1llm_D, 4m9v_C
Binding Motifs: 6b0r_D GCGTGGGAGGGtt
Binding Sites: 6b0r_E
6b0r_F
Publications: Wang D, Horton JR, Zheng Y, Blumenthal RM, Zhang X, Cheng X. Role for first zinc finger of WT1 in DNA sequence specificity: Denys-Drash syndrome-associated WT1 mutant in ZF1 enhances affinity for a subset of WT1 binding sites. Nucleic Acids Res 46:3864-3877 (2018). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.