Transcription Factor

						

			
Accessions: 6b0r_D (3D-footprint 20231221)

			
Names: Wilms tumor protein, WT1_HUMAN, WT33
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Length: 117
Pfam Domains:      6-28 C2H2-type zinc finger
    20-47 Zinc-finger double domain
    34-58 C2H2-type zinc finger
    34-58 Zinc finger, C2H2 type
    51-75 Zinc-finger double domain
    64-86 Zinc finger, C2H2 type
    64-86 C2H2-type zinc finger
   78-104 Zinc-finger double domain
   92-114 C2H2-type zinc finger
   92-116 Zinc finger, C2H2 type
Sequence: 
(in bold interface residues)		   1 MRPFMCAYPGCNKRYFKLSHLQRHSRKHTGEKPYQCDFKDCERRFSRSDQLKRHQRRHTG   60
  61 VKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFARSDELVRHHNMHQ
Interface Residues: 16, 17, 18, 19, 20, 22, 23, 25, 26, 29, 46, 47, 48, 49, 50, 52, 53, 57, 74, 75, 76, 77, 78, 79, 80, 81, 82, 104, 105, 106, 107, 108, 109, 110, 111, 112
3D-footprint Homologues: 7n5w_A, 6jnm_A, 3uk3_C, 2kmk_A, 8ssu_A, 6ml4_A, 5v3j_F, 6blw_A, 5kkq_D, 6u9q_A, 2i13_A, 5ei9_F, 8ssq_A, 7w1m_H, 5und_A, 5k5i_A, 2gli_A, 8h9h_G, 7eyi_G, 2lt7_A, 1tf6_A, 6e94_A, 7ysf_A, 6wmi_A, 2jpa_A, 1ubd_C, 1tf3_A, 7y3l_A, 8cuc_F, 1g2f_F, 5yel_A, 4x9j_A, 7txc_E, 5kl3_A, 2wbs_A, 1mey_C, 2drp_D, 1f2i_J, 7y3m_I, 6a57_A, 8gn3_A, 1llm_D, 5yj3_D, 4m9v_C
Binding Motifs: 6b0r_D GCGTGGGAGGGtt
Binding Sites: 6b0r_E
6b0r_F
			
Publications: Wang D, Horton JR, Zheng Y, Blumenthal RM, Zhang X, Cheng X. Role for first zinc finger of WT1 in DNA sequence specificity: Denys-Drash syndrome-associated WT1 mutant in ZF1 enhances affinity for a subset of WT1 binding sites. Nucleic Acids Res 46:3864-3877 (2018). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.