Transcription Factor
| Accessions: | 3fhz_A (3D-footprint 20260701), 3fhz_E (3D-footprint 20260701), 3fhz_F (3D-footprint 20260701), 3laj_D (3D-footprint 20260701), 3laj_F (3D-footprint 20260701) |
| Names: | Arginine repressor, ARGR_MYCTU |
| Organisms: | Mycobacterium tuberculosis, strain ATCC 25618 / H37Rv |
| Libraries: | 3D-footprint 20260701 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P9WPY8 |
| Length: | 155 |
| Pfam Domains: | 1-70 Arginine repressor, DNA binding domain 86-153 Arginine repressor, C-terminal domain |
| Sequence: (in bold interface residues) | 1 ANRAGRQARIVAILSSAQVRSQNELAALLAAEGIEVTQATLSRDLEELGAVKLRGADGGT 60 61 GIYVVPEDGSPVRGVSGGTDRMARLLGELLVSTDDSGNLAVLRTPPGAAHYLASAIDRAA 120 121 LPQVVGTIAGDDTILVVAREPTTGAQLAGMFENLR |
| Interface Residues: | 37, 38, 39, 40, 42, 43 |
| 3D-footprint Homologues: | 3lap_B, 4u7b_B, 2p5l_D |
| Binding Motifs: | 3laj_BF TGCATAnnGATGC 3fhz_AD TGCATAnngATTMA 3fhz_BF TGAATcnnTAyTCA 3fhz_CE TGAaTAnngATGCA 3fhz_E gATgCA 3laj_AD GCATCnnTATGCA |
| Binding Sites: | 3laj_I / 3laj_K 3laj_J / 3laj_L 3fhz_I / 3fhz_K 3fhz_J / 3fhz_L |
| Publications: | Cherney L.T, Cherney M.M, Garen C.R, James M.N. The structure of the arginine repressor from Mycobacterium tuberculosis bound with its DNA operator and Co-repressor, L-arginine. Journal of molecular biology 388:85-97 (2009). [Pubmed] Cherney L.T, Cherney M.M, Garen C.R, James M.N. Crystal structure of the intermediate complex of the arginine repressor from Mycobacterium tuberculosis bound with its DNA operator reveals detailed mechanism of arginine repression. Journal of molecular biology 399:240-54 (2010). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.