Transcription Factor

Accessions: T14197 (AthalianaCistrome v4_May2016)
Names: AT3G26620, LBD23, T14197;
Organisms: Arabidopsis thaliana
Libraries: AthalianaCistrome v4_May2016 1
1 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed]
Notes: ecotype:Col-0, experiment type: ampDAP-seq, experiment type: ampDAP-seq (methyl-cytosines removed by PCR), experiment type: DAP-seq, family:LOB-AS2
Length: 121
Pfam Domains: 5-105 Protein of unknown function DUF260
Sequence:
(in bold interface residues)
1 MNPKRCAACKYLRRRCPKDCVFSPYFPPNDPQKFACVHRIYGAGNVSKMLQQLPDQTRAE 60
61 AVESLCFEAKCRVDDPVYGCVGIIHLLKTQIQKTQNELAKTQAEIAVAQTKLSQTHISDF 120
121 M
Interface Residues: 56
3D-footprint Homologues: 4abt_B
Binding Motifs: M0472 rGCGwaaratrCGCy
M0474 rGCGkawTtymCGCy
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.