Transcription Factor

Accessions: T060869_1.02 (CISBP 1.02)
Names: K02D7.2, T060869_1.02;
Organisms: Caenorhabditis elegans
Libraries: CISBP 1.02 1
1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed]
Notes: experiment type:PBM, family:C2H2 ZF
Length: 193
Pfam Domains: 42-63 C2H2-type zinc finger
71-92 Zinc finger, C2H2 type
71-92 C2H2-type zinc finger
72-90 Zinc-finger of C2H2 type
97-118 Zinc finger, C2H2 type
97-118 C2H2-type zinc finger
112-134 Zinc-finger double domain
125-146 Zinc finger, C2H2 type
126-146 C2H2-type zinc finger
126-144 Zinc-finger of C2H2 type
138-162 Zinc-finger double domain
Sequence:
(in bold interface residues)
1 MSINTKRKSIFETIEDLISPDPAPSSSSSSASCSSLDNQKLVCQFCKKTYLTYFGLRRHL 60
61 QFHKEGKLQQSCPHCKKVYRSPGALKMHLKTHSLPCVCNDCGKSFSRPWLLKGHLRTHTG 120
121 EKPFGCEFCGRCFADRSNLRAHLQTHSGEKKHRCSRCGQSFARVQVRQRHEQCCRGGGSG 180
181 GEAEKEDVEVDGD
Interface Residues: 51, 52, 54, 55, 58, 80, 81, 82, 83, 84, 85, 86, 87, 89, 90, 93, 106, 107, 108, 109, 110, 112, 113, 114, 134, 135, 136, 137, 138, 139, 140, 141, 142, 145, 162, 163, 164, 165, 166, 169
3D-footprint Homologues: 7w1m_H, 5v3j_F, 6jnm_A, 7n5w_A, 6ml4_A, 8ssq_A, 5kkq_D, 5ei9_F, 8ssu_A, 6joo_A, 6blw_A, 5k5l_F, 8h9h_G, 7ysf_A, 6e94_A, 6a57_A, 2jpa_A, 1ubd_C, 1tf3_A, 8cuc_F, 7y3l_A, 3uk3_C, 1llm_D, 5yel_A, 4x9j_A, 2gli_A, 6u9q_A, 1f2i_J, 5kl3_A, 1tf6_A, 5k5i_A, 2kmk_A, 1g2f_F, 7txc_E, 4m9v_C, 2lt7_A, 7y3m_I, 8gn3_A, 2wbs_A, 5yj3_D
Binding Motifs: M0458_1.02 ACAGGTG
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.