Transcription Factor
| Accessions: | T060869_1.02 (CISBP 1.02) |
| Names: | K02D7.2, T060869_1.02; |
| Organisms: | Caenorhabditis elegans |
| Libraries: | CISBP 1.02 1 1 Weirauch MT, Yang A, Albu M, Cote AG, Montenegro-Montero A, Drewe P, Najafabadi HS, Lambert SA, Mann I, Cook K, Zheng H, Goity A, van Bakel H, Lozano JC, Galli M, Lewsey MG, Huang E, Mukherjee T, Chen X, Reece-Hoyes JS, Govindarajan S, Shaulsky G, et al. Determination and inference of eukaryotic transcription factor sequence specificity. Cell. 2014 Sep 11;158(6):1431-43. doi: 10.1016/j.cell.2014.08.009. [Pubmed] |
| Notes: | experiment type:PBM, family:C2H2 ZF |
| Length: | 193 |
| Pfam Domains: | 42-63 C2H2-type zinc finger 71-92 Zinc finger, C2H2 type 71-92 C2H2-type zinc finger 72-90 Zinc-finger of C2H2 type 97-118 Zinc finger, C2H2 type 97-118 C2H2-type zinc finger 112-134 Zinc-finger double domain 125-146 Zinc finger, C2H2 type 126-146 C2H2-type zinc finger 126-144 Zinc-finger of C2H2 type 138-162 Zinc-finger double domain |
| Sequence: (in bold interface residues) | 1 MSINTKRKSIFETIEDLISPDPAPSSSSSSASCSSLDNQKLVCQFCKKTYLTYFGLRRHL 60 61 QFHKEGKLQQSCPHCKKVYRSPGALKMHLKTHSLPCVCNDCGKSFSRPWLLKGHLRTHTG 120 121 EKPFGCEFCGRCFADRSNLRAHLQTHSGEKKHRCSRCGQSFARVQVRQRHEQCCRGGGSG 180 181 GEAEKEDVEVDGD |
| Interface Residues: | 51, 52, 54, 55, 58, 80, 81, 82, 83, 84, 85, 86, 87, 89, 90, 93, 106, 107, 108, 109, 110, 112, 113, 114, 134, 135, 136, 137, 138, 139, 140, 141, 142, 145, 162, 163, 164, 165, 166, 169 |
| 3D-footprint Homologues: | 7w1m_H, 5v3j_F, 6wmi_A, 2i13_A, 6jnm_A, 7n5w_A, 5k5l_F, 8ssq_A, 6joo_A, 6blw_A, 5kkq_D, 8ssu_A, 6ml4_A, 5ei9_F, 7eyi_G, 8h9h_G, 7ysf_A, 6e94_A, 6a57_A, 2jpa_A, 1ubd_C, 1tf3_A, 8cuc_F, 7y3l_A, 3uk3_C, 1mey_C, 7txc_E, 5und_A, 2gli_A, 1f2i_J, 4x9j_A, 1g2f_F, 1tf6_A, 5yel_A, 1llm_D, 5kl3_A, 6u9q_A, 5k5i_A, 2kmk_A, 4m9v_C, 2lt7_A, 7y3m_I, 8gn3_A, 2wbs_A, 5yj3_D |
| Binding Motifs: | M0458_1.02 ACAGGTG |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.