Transcription Factor
| Accessions: | sr (FlyZincFinger 1.0 ) |
| Names: | CG7847 |
| Organisms: | Drosophila melanogaster |
| Libraries: | FlyZincFinger 1.0 1 1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed] |
| Notes: | family:Cys2His2 zinc finger |
| Length: | 119 |
| Pfam Domains: | 31-55 C2H2-type zinc finger 31-55 Zinc finger, C2H2 type 48-71 Zinc-finger double domain 61-83 C2H2-type zinc finger 61-83 Zinc finger, C2H2 type 75-99 Zinc-finger double domain 89-111 Zinc finger, C2H2 type 89-111 C2H2-type zinc finger 90-100 zinc-finger of a C2HC-type |
| Sequence: (in bold interface residues) | 1 QQSTVPLKLVPVKPRKYPNRPSKTPVHERPYACPVENCDRRFSRSDELTRHIRIHTGQKP 60 61 FQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDICGRKFARSDEKKRHAKVHLKQRIKKE |
| Interface Residues: | 20, 22, 23, 43, 44, 45, 46, 47, 49, 50, 71, 72, 73, 74, 75, 77, 78, 79, 99, 100, 101, 102, 103, 104, 105, 106, 107 |
| 3D-footprint Homologues: | 5ei9_F, 7ysf_A, 6blw_A, 5yel_A, 7n5w_A, 6jnm_A, 1tf3_A, 2jpa_A, 1g2f_F, 5kl3_A, 1ubd_C, 2kmk_A, 6ml4_A, 8ssq_A, 7w1m_H, 5k5l_F, 6u9q_A, 4x9j_A, 2gli_A, 8ssu_A, 1f2i_J, 5kkq_D, 2wbs_A, 1tf6_A, 8h9h_G, 5v3j_F, 2lt7_A, 6e94_A, 6a57_A, 3uk3_C, 8cuc_F, 7y3l_A, 7txc_E, 5k5i_A, 1llm_D, 2drp_D, 4m9v_C, 7y3m_I, 8gn3_A, 5yj3_D |
| Binding Motifs: | sr_SANGER_5_FBgn0003499 kkrbGkGGGCGkkd sr_SOLEXA_5_FBgn0003499 kkgyGkGGGyGkgk |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.