Transcription Factor

						

			
Accessions: sr (FlyZincFinger 1.0 )

			
Names: CG7847
Organisms: Drosophila melanogaster
Libraries: FlyZincFinger 1.0  1
1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed]
Notes: family:Cys2His2 zinc finger
Length: 119
Pfam Domains:     31-55 C2H2-type zinc finger
    31-55 Zinc finger, C2H2 type
    48-71 Zinc-finger double domain
    61-83 C2H2-type zinc finger
    61-83 Zinc finger, C2H2 type
    75-99 Zinc-finger double domain
   89-111 C2H2-type zinc finger
   89-111 Zinc finger, C2H2 type
   90-100 zinc-finger of a C2HC-type
Sequence: 
(in bold interface residues)		   1 QQSTVPLKLVPVKPRKYPNRPSKTPVHERPYACPVENCDRRFSRSDELTRHIRIHTGQKP   60
  61 FQCRICMRSFSRSDHLTTHIRTHTGEKPFSCDICGRKFARSDEKKRHAKVHLKQRIKKE
Interface Residues: 20, 22, 23, 43, 44, 45, 46, 47, 49, 50, 71, 72, 73, 74, 75, 77, 78, 79, 99, 100, 101, 102, 103, 104, 105, 106, 107
3D-footprint Homologues: 6blw_A, 5yel_A, 5ei9_F, 7ysf_A, 1tf3_A, 6jnm_A, 7n5w_A, 5kkq_D, 2wbs_A, 1ubd_C, 6u9q_A, 2jpa_A, 1mey_C, 5kl3_A, 1f2i_J, 6wmi_A, 2kmk_A, 8ssq_A, 7w1m_H, 5und_A, 2gli_A, 1g2f_F, 5k5l_F, 8ssu_A, 1tf6_A, 6ml4_A, 4x9j_A, 2i13_A, 8h9h_G, 7eyi_G, 5v3j_F, 6e94_A, 2lt7_A, 6a57_A, 3uk3_C, 8cuc_F, 7y3l_A, 7txc_E, 2drp_D, 5k5i_A, 1llm_D, 4m9v_C, 7y3m_I, 8gn3_A, 5yj3_D
Binding Motifs: sr_SANGER_5_FBgn0003499 kkrbGkGGGCGkkd
sr_SOLEXA_5_FBgn0003499 kkgyGkGGGyGkgk
			
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.