Transcription Factor

						

			
Accessions: 3a5t_A (3D-footprint 20231221)

			
Names: MAFG_MOUSE, Transcription factor MafG, V-maf musculoaponeurotic fibrosarcoma oncogene homolog G
Organisms: Mus musculus
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: O54790
Length: 93
Pfam Domains:      5-93 bZIP Maf transcription factor
Sequence: 
(in bold interface residues)		   1 HMGTSLTDEELVTMSVRELNQHLRGLSKEEIIQLKQRRRTLKNRGYAASCRVKRVTQKEE   60
  61 LEKQKAELQQEVEKLASENASMKLELDALRSKY
Interface Residues: 39, 43, 46, 47, 50, 51
3D-footprint Homologues: 2wt7_B, 4eot_A, 7x5e_E, 2wt7_A, 7x5e_F
Binding Motifs: 3a5t_AB TGAtAAGTTaGCA
			
Publications: Kurokawa H, Motohashi H, Sueno S, Kimura M, Takagawa H, Kanno Y, Yamamoto M, Tanaka T. Structural basis of alternative DNA recognition by Maf transcription factors. Molecular and cellular biology 29:6232-44 (2009). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.