Transcription Factor
| Accessions: | ATHB51 (ArabidopsisPBM 20140210), Q9LZR0 (JASPAR 2024), T25843 (AthalianaCistrome v4_May2016) |
| Names: | ATHB51, LMI1, ATB51_ARATH, HD-ZIP protein ATHB-51, Homeodomain transcription factor ATHB-51, Putative homeobox-leucine zipper protein ATHB-51, AT5G03790, T25843; |
| Organisms: | Arabidopsis thaliana |
| Libraries: | ArabidopsisPBM 20140210 1, JASPAR 2024 2, AthalianaCistrome v4_May2016 3 1 Franco-Zorrilla J.M, López-Vidriero I, Carrasco J.L, Godoy M, Vera P, Solano R. DNA-binding specificities of plant transcription factors and their potential to define target genes. Proceedings of the National Academy of Sciences of the United States of America : (2014). [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] 3 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed] |
| Notes: | HD (HD-ZIPI), ecotype:Col-0, experiment type: ampDAP-seq, experiment type: ampDAP-seq (methyl-cytosines removed by PCR), experiment type: DAP-seq, family:HB |
| Length: | 235 |
| Pfam Domains: | 78-130 Homeobox domain |
| Sequence: (in bold interface residues) | 1 MEWSTTSNVENVRVAFMPPPWPESSSFNSLHSFNFDPYAGNSYTPGDTQTGPVISVPESE 60 61 KIMNAYRFPNNNNEMIKKKRLTSGQLASLERSFQEEIKLDSDRKVKLSRELGLQPRQIAV 120 121 WFQNRRARWKAKQLEQLYDSLRQEYDVVSREKQMLHDEVKKLRALLRDQGLIKKQISAGT 180 181 IKVSGEEDTVEISSVVVAHPRTENMNANQITGGNQVYGQYNNPMLVASSGWPSYP |
| Interface Residues: | 63, 69, 70, 73, 77, 78, 79, 80, 81, 116, 117, 119, 120, 123, 124, 126, 127, 128, 131, 133, 138, 139 |
| 3D-footprint Homologues: | 5zfz_A, 1puf_A, 8ejp_B, 5zjt_E, 4cyc_A, 6a8r_A, 5jlw_D, 2ld5_A, 1nk2_P, 7psx_B, 1au7_A, 8ik5_C, 8osb_E, 1ig7_A, 7q3o_C, 1e3o_C, 1le8_A, 1b72_A, 5hod_A, 3cmy_A, 1zq3_P, 8eml_B, 4qtr_D, 2lkx_A, 1o4x_A, 8pmf_A, 1du0_A, 3lnq_A, 2hdd_A, 1jgg_B, 8g87_X, 6es3_K, 4xrs_G, 2r5y_A, 9b8u_A, 8bx1_A, 3rkq_B, 5flv_I, 3a01_E, 1puf_B, 1fjl_B, 2hos_A, 6m3d_C |
| Binding Motifs: | ATHB51 yMATwATTGm MA0952.1 MATwATTG M0411 TCAATTATTGktt M0413 yTcAATTATTGdt |
| Binding Sites: | MA0952.1.1 MA0952.1.10 MA0952.1.11 MA0952.1.12 MA0952.1.13 MA0952.1.14 MA0952.1.15 MA0952.1.16 MA0952.1.17 MA0952.1.18 MA0952.1.19 MA0952.1.2 MA0952.1.20 MA0952.1.3 MA0952.1.4 MA0952.1.5 MA0952.1.6 MA0952.1.7 MA0952.1.8 MA0952.1.9 |
| Publications: | Saddic LA, Huvermann B, Bezhani S, Su Y, Winter CM, Kwon CS, Collum RP, Wagner D. The LEAFY target LMI1 is a meristem identity regulator and acts together with LEAFY to regulate expression of CAULIFLOWER. Development 133:1673-82 (2006). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.