Transcription Factor

						

			
Accessions: KLF10 (HT-SELEX2 May2017)

			
Names: ENSG00000155090, KLF10
Organisms: Homo sapiens
Libraries: HT-SELEX2 May2017 1
1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Notes: TF family: Znf_C2H2 experiment: HT-SELEX Hamming distance: 2 cycle: 4, TF family: Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 2 cycle: 4
Length: 120
Pfam Domains:     16-40 C2H2-type zinc finger
    17-40 Zinc finger, C2H2 type
    32-58 Zinc-finger double domain
    46-70 C2H2-type zinc finger
    46-70 Zinc finger, C2H2 type
    63-85 Zinc-finger double domain
    76-98 C2H2-type zinc finger
    76-98 Zinc finger, C2H2 type
Sequence: 
(in bold interface residues)		   1 AAKVTPQIDSSRIRSHICSHPGCGKTYFKSSHLKAHTRTHTGEKPFSCSWKGCERRFARS   60
  61 DELSRHRRTHTGEKKFACPMCDRRFMRSDHLTKHARRHLSAKKLPNWQMEVSKLNDIALP  120
Interface Residues: 9, 11, 12, 15, 28, 29, 30, 31, 32, 34, 35, 37, 38, 41, 54, 56, 58, 59, 60, 61, 62, 64, 65, 66, 86, 87, 88, 89, 90, 91, 92, 93, 94, 97, 113, 114, 115, 116, 119
3D-footprint Homologues: 6ml4_A, 8cuc_F, 7y3l_A, 1tf3_A, 7n5w_A, 6jnm_A, 3uk3_C, 6blw_A, 2kmk_A, 6u9q_A, 8ssu_A, 5kkq_D, 4x9j_A, 2gli_A, 5kl3_A, 1tf6_A, 5ei9_F, 1g2f_F, 7ysf_A, 1ubd_C, 8ssq_A, 7w1m_H, 8h9h_G, 6e94_A, 2lt7_A, 6a57_A, 2jpa_A, 5k5i_A, 8gn3_A, 1llm_D, 5yel_A, 2drp_D, 5yj3_D, 1f2i_J, 2wbs_A, 7txc_E, 4m9v_C, 7y3m_I, 5v3j_F
Binding Motifs: KLF10_2 gmCACrCCCmygmCACrCCCmC
KLF10_methyl_1 GmCACrCCCmYGmCACrCCCmC
			
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.