Transcription Factor

Accessions: 5no6_N (3D-footprint 20231221)
Names: TEA domain family member 4, TEAD-4, TEAD4_HUMAN, Transcription factor 13-like 1, Transcription factor RTEF-1, Transcriptional enhancer factor TEF-3
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q15561
Length: 73
Pfam Domains: 1-68 TEA/ATTS domain family
Sequence:
(in bold interface residues)
1 EGVWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVS 60
61 SHIQVLARRKARE
Interface Residues: 35, 39, 56, 57, 60, 61, 64, 65, 68
3D-footprint Homologues: 5gzb_A, 5no6_N
Binding Motifs: 5no6_AN GGAATgcnATAaA
5no6_N TnnnntATTCC
Binding Sites: 5no6_C
5no6_F
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.