Transcription Factor
| Accessions: | 4euw_A (3D-footprint 20231221) |
| Names: | SOX9_HUMAN, Transcription factor SOX-9 |
| Organisms: | Homo sapiens |
| Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | P48436 |
| Length: | 72 |
| Pfam Domains: | 3-71 HMG (high mobility group) box 4-66 Domain of unknown function (DUF1898) |
| Sequence: (in bold interface residues) | 1 PHVKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLNESEKRPFVEEAERLR 60 61 VQHKKDHPDYKY |
| Interface Residues: | 5, 8, 10, 11, 14, 18, 29, 30, 31, 34, 36, 37, 39, 41, 42, 72 |
| 3D-footprint Homologues: | 1j5n_A, 2lef_A, 3u2b_C, 1o4x_B, 6jrp_D, 3f27_D, 4s2q_D, 1qrv_A, 7m5w_A, 3tmm_A, 4y60_C, 2gzk_A, 3tq6_B, 1hry_A, 6jbx_A |
| Binding Motifs: | 4euw_A TcAAAg |
| Binding Sites: | 4euw_B 4euw_C |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.