Transcription Factor

Accessions: Q9LX86 (JASPAR 2024), T11523 (AthalianaCistrome v4_May2016)
Names: C2H2-type zinc finger family protein, Q9LX86_ARATH, Uncharacterized protein At3g46070, Zinc finger-like protein, AT3G46070, T11523;
Organisms: Arabidopsis thaliana
Libraries: JASPAR 2024 1, AthalianaCistrome v4_May2016 2
1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
2 O'Malley RC, Huang SS, Song L, Lewsey MG, Bartlett A, Nery JR, Galli M, Gallavotti A, Ecker JR. Cistrome and Epicistrome Features Shape the Regulatory DNA Landscape. Cell 165:1280-92 (2016). [Pubmed]
Notes: ecotype:Col-0, experiment type: DAP-seq, family:C2H2
Length: 170
Pfam Domains: 35-60 C2H2-type zinc finger
86-110 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 MVAESDNRDLTVDTAASCLMLLSGIGEHDGRKKRVFRCKTCERDFDSFQALGGHRASHSK 60
61 LTNSDDKSLPGSPKKKPKTTTTTTAHTCPICGLEFPMGQALGGHMRKHRNEKEREKASNV 120
121 LVTHSFMPETTTVTTLKKSSSGKRVACLDFDLTSVESFVNTELELGRTMY
Interface Residues: 12, 13, 14, 36, 47, 48, 49, 50, 53, 63, 64, 66, 67, 70, 71, 72, 73, 75, 77, 78, 81, 96, 97, 98, 99, 100, 103
3D-footprint Homologues: 5v3j_F, 2kmk_A, 7ysf_A, 8gh6_A, 6ml4_A, 7y3l_A, 7n5w_A, 8h9h_G
Binding Motifs: M0334 / MA1381.1 yywhyyTCACTcthh
MA1381.2 TCACTct
Publications: Hichri I, Muhovski Y, Žižkova E, Dobrev PI, Franco-Zorrilla JM, Solano R, Lopez-Vidriero I, Motyka V, Lutts S. The Solanum lycopersicum Zinc Finger2 cysteine-2/histidine-2 repressor-like transcription factor regulates development and tolerance to salinity in tomato and Arabidopsis. Plant Physiol 164:1967-90 (2014). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.