Transcription Factor

						

			
Accessions: ZNF580 (HT-SELEX2 May2017)

			
Names: ENSG00000213015, ZNF580
Organisms: Homo sapiens
Libraries: HT-SELEX2 May2017 1
1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed]
Notes: TF family: Znf_C2H2  experiment: HT-SELEX Hamming distance: 2 cycle: 4, TF family: Znf_C2H2 experiment: HT-SELEX Hamming distance: 2 cycle: 4, TF family: Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 2 cycle: 4
Length: 95
Pfam Domains:     16-38 Zinc finger, C2H2 type
    16-37 C2H2-type zinc finger
    16-38 C2H2-type zinc finger
    31-55 Zinc-finger double domain
    43-68 C2H2-type zinc finger
    44-66 Zinc finger, C2H2 type
    44-66 C2H2-type zinc finger
    58-83 Zinc-finger double domain
    73-85 C2H2-type zinc finger
    74-94 Zinc finger, C2H2 type
    74-94 C2H2-type zinc finger
Sequence: 
(in bold interface residues)		   1 PQREAPPGEPGPRKGYSCPECARVFASPLRLQSHRVSHSDLKPFTCGACGKAFKRSSHLS   60
  61 RHRATHRARAGPPHTCPLCPRRFQDAAELAQHVRL
Interface Residues: 16, 26, 27, 28, 29, 30, 33, 36, 54, 55, 56, 57, 58, 60, 61, 62, 84, 85, 86, 87, 88, 89, 90, 91, 92, 95
3D-footprint Homologues: 2kmk_A, 6jnm_A, 3uk3_C, 8cuc_F, 7y3l_A, 1tf3_A, 7n5w_A, 2gli_A, 1f2i_J, 5kl3_A, 1tf6_A, 5ei9_F, 2jpa_A, 1g2f_F, 6ml4_A, 8ssq_A, 7w1m_H, 6blw_A, 1llm_D, 6u9q_A, 8ssu_A, 5kkq_D, 2lt7_A, 8gn3_A, 4x9j_A, 8h9h_G, 7y3m_I, 7ysf_A, 6e94_A, 6a57_A, 1ubd_C, 2wbs_A, 7txc_E, 5v3j_F, 5k5i_A, 5yel_A, 2drp_D, 5yj3_D, 4m9v_C
Binding Motifs: ZNF580_2 cCTACCCyyrcCTACCCy
ZNF580_5 cCTACCcymcmmCTACCct
ZNF580_6 yrTTATGTTAAATwrTTACChtw
ZNF580_methyl_1 cCTACCCTyrCCTACCCT
ZNF580_methyl_3 mCTACCctmcmmCTACCct
ZNF580_methyl_4 brTTATGTTAAATwrTTACChTr
			
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.