Transcription Factor

Accessions: 4iri_A (3D-footprint 20250804)
Names: ERG_HUMAN, Transcriptional regulator ERG, Transforming protein ERG
Organisms: Homo sapiens
Libraries: 3D-footprint 20250804 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P11308
Length: 94
Pfam Domains: 2-84 Ets-domain
Sequence:
(in bold interface residues)
1 GQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRA 60
61 LRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPH
Interface Residues: 55, 56, 58, 59, 60, 62, 63, 77
3D-footprint Homologues: 4uno_A, 2stt_A, 8smj_F, 7jsa_J, 3jtg_A, 1dux_F, 8ee9_F, 3zp5_A, 4mhg_A, 8smh_F, 4l18_B, 1bc8_C, 4lg0_B, 1yo5_C, 4iri_A, 1awc_A
Binding Motifs: 4iri_A CGGAag
Binding Sites: 4iri_B
4iri_C
Publications: Regan M.C, Horanyi P.S, Pryor E.E, Sarver J.L, Cafiso D.S, Bushweller J.H. Structural and dynamic studies of the transcription factor ERG reveal DNA binding is allosterically autoinhibited. Proceedings of the National Academy of Sciences of the United States of America 110:13374-9 (2013). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.