Transcription Factor

Accessions: 5jlw_D (3D-footprint 20241219), 5jlx_A (3D-footprint 20241219)
Names: ANTP_DROME, Homeotic protein antennapedia
Organisms: Drosophila melanogaster
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P02833
Length: 57
Pfam Domains: 2-55 Homeobox domain
Sequence:
(in bold interface residues)
1 GRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKEN
Interface Residues: 2, 40, 41, 43, 44, 47, 48, 50, 51, 52, 55
3D-footprint Homologues: 6m3d_C, 9b8u_A, 8ik5_C, 7psx_B, 2hdd_A, 8ejp_B, 4cyc_A, 8osb_E, 7q3o_C, 2hos_A, 8eml_B, 6es3_K, 8pmf_A, 2ld5_A, 7xrc_C, 8g87_X, 1zq3_P, 8bx1_A, 2lkx_A
Binding Motifs: 5jlw_D CATTAG
5jlx_A GCATTAG
Binding Sites: 5jlw_F / 5jlx_C
5jlw_E / 5jlx_B
Publications: Nguyen D, Zandarashvili L, White MA, Iwahara J. Stereospecific Effects of Oxygen-to-Sulfur Substitution in DNA Phosphate on Ion Pair Dynamics and Protein-DNA Affinity. Chembiochem 17:1636-42 (2016). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.