Transcription Factor
Accessions: | ECK120004828 (RegulonDB 7.5) |
Names: | Fur |
Organisms: | ECK12 |
Libraries: | RegulonDB 7.5 1 1 Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muniz-Rascado L, Garcia-Sotelo JS, Weiss V, Solano-Lira H, Martinez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernandez S, Alquicira-Hernandez K, Lopez-Fuentes A, Porron-Sotelo L, Huerta AM, Bonavides-Martinez C, Balderas-Martinez YI, Pannier L, Olvera M, Labastida A, Jimenez-Jacinto V, Vega-Alvarado L, Del Moral-Chavez V, Hernandez-Alvarez A, Morett E, Collado-Vides J. RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more. Nucleic Acids Res. 2013 Jan 1;41(D1):D203-D213. [Pubmed] |
Notes: | repressor; regulon; activator; Transcription related; cytoplasm; zinc ion binding; sequence-specific DNA binding transcription factor activity; DNA binding; transcription activator activity; transcription, DNA-dependent; negative regulation of transcription, DNA-dependent; transcription repressor activity; regulation of transcription, DNA-dependent |
Length: | 149 |
Pfam Domains: | 10-130 Ferric uptake regulator family |
Sequence: (in bold interface residues) | 1 MTDNNTALKKAGLKVTLPRLKILEVLQEPDNHHVSAEDLYKRLIDMGEEIGLATVYRVLN 60 61 QFDDAGIVTRHNFEGGKSVFELTQQHHHDHLICLDCGKVIEFSDDSIEARQREIAAKHGI 120 121 RLTNHSLYLYGHCAEGDCREDEHAHEGK* |
Interface Residues: | 14, 37, 51, 52, 53, 54, 56, 57, 78, 98, 99 |
3D-footprint Homologues: | 7vo0_N, 7vpz_N, 4rb3_D, 4mtd_D, 7x74_H, 4aik_A, 3thx_B |
Binding Motifs: | Fur AATGAkAAtgATTwtyAw |
Binding Sites: | ECK120011181 ECK120011184 ECK120011521 ECK120011523 ECK120011525 ECK120011527 ECK120011529 ECK120011535 ECK120011539 ECK120011696 ECK120011699 ECK120011701 ECK120011737 ECK120012032 ECK120012385 ECK120012392 ECK120012394 ECK120012396 ECK120012398 ECK120012400 ECK120012656 ECK120012659 ECK120012886 ECK120012888 ECK120013121 ECK120013124 ECK120013127 ECK120013496 ECK120013537 ECK120015641 ECK120015643 ECK120015645 ECK120015647 ECK120016006 ECK120016008 ECK120016010 ECK120016012 ECK120016014 ECK120016018 ECK120016032 ECK120016036 ECK120016058 ECK120016143 ECK120016484 ECK120016496 ECK120017054 ECK120023166 ECK120030708 ECK120030710 ECK120030712 ECK120030715 ECK120030740 ECK120033085 ECK120033347 ECK120033348 ECK120033921 ECK120033925 ECK120033927 ECK120033930 ECK120033932 ECK120033934 ECK120033936 ECK120033938 ECK120033940 ECK120033943 ECK120033945 ECK120033947 ECK125108650 ECK125108654 ECK125108656 ECK125108658 ECK125110197 ECK125110199 ECK125110201 ECK125110203 ECK125110205 ECK125110207 ECK125110243 ECK125110245 ECK125110260 ECK125134861 ECK125134863 ECK125134865 ECK125140761 |
Publications: | Zhang Z., Gosset G., Barabote R., Gonzalez CS., Cuevas WA., Saier MH. Functional interactions between the carbon and iron utilization regulators, Crp and Fur, in Escherichia coli. J Bacteriol. 187(3):980-90 (2005). [Pubmed] Jabour S., Hamed MY. Binding of the Zn(2+) ion to ferric uptake regulation protein from E. coli and the competition with Fe(2+) binding: a molecular modeling study of the effect on DNA binding and conformational changes of Fur. J Comput Aided Mol Des. 23(4):199-208 (2009). [Pubmed] Pecqueur L., D'Autreaux B., Dupuy J., Nicolet Y., Jacquamet L., Brutscher B., Michaud-Soret I., Bersch B. Structural changes of Escherichia coli ferric uptake regulator during metal-dependent dimerization and activation explored by NMR and X-ray crystallography. J Biol Chem. 281(30):21286-95 (2006). [Pubmed] Spiro S. Nitric oxide-sensing mechanisms in Escherichia coli. Biochem Soc Trans. 34(Pt 1):200-2 (2006). [Pubmed] Saito T., Williams RJ. The binding of the ferric uptake regulation protein to a DNA fragment. Eur J Biochem. 197(1):43-7 (1991). [Pubmed] Baichoo N., Helmann JD. Recognition of DNA by Fur: a reinterpretation of the Fur box consensus sequence. J Bacteriol. 184(21):5826-32 (2002). [Pubmed] Lavrrar JL., McIntosh MA. Architecture of a fur binding site: a comparative analysis. J Bacteriol. 185(7):2194-202 (2003). [Pubmed] Hamed MY., Al-Jabour S. Iron(II) triggered conformational changes in Escherichia coli fur upon DNA binding: a study using molecular modeling. J Mol Graph Model. 25(2):234-46 (2006). [Pubmed] Coulton JW., Mason P., Cameron DR., Carmel G., Jean R., Rode HN. Protein fusions of beta-galactosidase to the ferrichrome-iron receptor of Escherichia coli K-12. J Bacteriol. 165(1):181-92 (1986). [Pubmed] Chen Z., Lewis KA., Shultzaberger RK., Lyakhov IG., Zheng M., Doan B., Storz G., Schneider TD. Discovery of Fur binding site clusters in Escherichia coli by information theory models. Nucleic Acids Res. 35(20):6762-77 (2007). [Pubmed] Newman DL., Shapiro JA. Differential fiu-lacZ fusion regulation linked to Escherichia coli colony development. Mol Microbiol. 33(1):18-32 (1999). [Pubmed] De Lorenzo V., Herrero M., Giovannini F., Neilands JB. Fur (ferric uptake regulation) protein and CAP (catabolite-activator protein) modulate transcription of fur gene in Escherichia coli. Eur J Biochem. 173(3):537-46 (1988). [Pubmed] Hantke K. Iron and metal regulation in bacteria. Curr Opin Microbiol. 4(2):172-7 (2001). [Pubmed] Vassinova N., Kozyrev D. A method for direct cloning of fur-regulated genes: identification of seven new fur-regulated loci in Escherichia coli. Microbiology. 146 Pt 12:3171-82 (2000). [Pubmed] D'Autreaux B., Touati D., Bersch B., Latour JM., Michaud-Soret I. Direct inhibition by nitric oxide of the transcriptional ferric uptake regulation protein via nitrosylation of the iron. Proc Natl Acad Sci U S A. 99(26):16619-24 (2002). [Pubmed] Angerer A., Braun V. Iron regulates transcription of the Escherichia coli ferric citrate transport genes directly and through the transcription initiation proteins. Arch Microbiol. 169(6):483-90 (1998). [Pubmed] Kammler M., Schon C., Hantke K. Characterization of the ferrous iron uptake system of Escherichia coli. J Bacteriol. 175(19):6212-9 (1993). [Pubmed] Griggs DW., Konisky J. Mechanism for iron-regulated transcription of the Escherichia coli cir gene: metal-dependent binding of fur protein to the promoters. J Bacteriol. 171(2):1048-52 (1989). [Pubmed] Outten FW., Djaman O., Storz G. A suf operon requirement for Fe-S cluster assembly during iron starvation in Escherichia coli. Mol Microbiol. 52(3):861-72 (2004). [Pubmed] Sauer M., Hantke K., Braun V. Sequence of the fhuE outer-membrane receptor gene of Escherichia coli K12 and properties of mutants. Mol Microbiol. 4(3):427-37 (1990). [Pubmed] de Lorenzo V., Wee S., Herrero M., Neilands JB. Operator sequences of the aerobactin operon of plasmid ColV-K30 binding the ferric uptake regulation (fur) repressor. J Bacteriol. 169(6):2624-30 (1987). [Pubmed] Arechaga I., Miroux B., Runswick MJ., Walker JE. Over-expression of Escherichia coli F1F(o)-ATPase subunit a is inhibited by instability of the uncB gene transcript. FEBS Lett. 547(1-3):97-100 (2003). [Pubmed] Stojiljkovic I., Baumler AJ., Hantke K. Fur regulon in gram-negative bacteria. Identification and characterization of new iron-regulated Escherichia coli genes by a fur titration assay. J Mol Biol. 236(2):531-45 (1994). [Pubmed] Tardat B., Touati D. Iron and oxygen regulation of Escherichia coli MnSOD expression: competition between the global regulators Fur and ArcA for binding to DNA. Mol Microbiol. 9(1):53-63 (1993). [Pubmed] Patzer SI., Hantke K. Dual repression by Fe(2+)-Fur and Mn(2+)-MntR of the mntH gene, encoding an NRAMP-like Mn(2+) transporter in Escherichia coli. J Bacteriol. 183(16):4806-13 (2001). [Pubmed] Koch D., Nies DH., Grass G. The RcnRA (YohLM) system of Escherichia coli: A connection between nickel, cobalt and iron homeostasis. Biometals. 20(5):759-71 (2007). [Pubmed] Graham AI., Sanguinetti G., Bramall N., McLeod CW., Poole RK. Dynamics of a starvation-to-surfeit shift: a transcriptomic and modelling analysis of the bacterial response to zinc reveals transient behaviour of the Fur and SoxS regulators. Microbiology. 158(Pt 1):284-92 (2012). [Pubmed] Puskarova A., Ferianc P., Kormanec J., Homerova D., Farewell A., Nystrom T. Regulation of yodA encoding a novel cadmium-induced protein in Escherichia coli. Microbiology. 148(Pt 12):3801-11 (2002). [Pubmed] Sumi T., Sekino H. A crossover from metal to plasma in dense fluid hydrogen. J Chem Phys. 125(19):194526 (2006). [Pubmed] Tseng CP. Regulation of fumarase (fumB) gene expression in Escherichia coli in response to oxygen, iron and heme availability: role of the arcA, fur, and hemA gene products. FEMS Microbiol Lett. 157(1):67-72 (1997). [Pubmed] Brickman TJ., Ozenberger BA., McIntosh MA. Regulation of divergent transcription from the iron-responsive fepB-entC promoter-operator regions in Escherichia coli. J Mol Biol. 212(4):669-82 (1990). [Pubmed] Lee JW., Helmann JD. Functional specialization within the Fur family of metalloregulators. Biometals. 20(3-4):485-99 (2007). [Pubmed] Masse E., Escorcia FE., Gottesman S. Coupled degradation of a small regulatory RNA and its mRNA targets in Escherichia coli. Genes Dev. 17(19):2374-83 (2003). [Pubmed] Semsey S., Andersson AM., Krishna S., Jensen MH., Masse E., Sneppen K. Genetic regulation of fluxes: iron homeostasis of Escherichia coli. Nucleic Acids Res. 34(17):4960-7 (2006). [Pubmed] Masse E., Vanderpool CK., Gottesman S. Effect of RyhB small RNA on global iron use in Escherichia coli. J Bacteriol. 187(20):6962-71 (2005). [Pubmed] Masse E., Gottesman S. A small RNA regulates the expression of genes involved in iron metabolism in Escherichia coli. Proc Natl Acad Sci U S A. 99(7):4620-5 (2002). [Pubmed] Vecerek B., Moll I., Afonyushkin T., Kaberdin V., Blasi U. Interaction of the RNA chaperone Hfq with mRNAs: direct and indirect roles of Hfq in iron metabolism of Escherichia coli. Mol Microbiol. 50(3):897-909 (2003). [Pubmed] Mills SA., Marletta MA. Metal binding characteristics and role of iron oxidation in the ferric uptake regulator from Escherichia coli. Biochemistry. 44(41):13553-9 (2005). [Pubmed] Althaus EW., Outten CE., Olson KE., Cao H., O'Halloran TV. The ferric uptake regulation (Fur) repressor is a zinc metalloprotein. Biochemistry. 38(20):6559-69 (1999). [Pubmed] Clarke TE., Tari LW., Vogel HJ. Structural biology of bacterial iron uptake systems. Curr Top Med Chem. 1(1):7-30 (2001). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.