Transcription Factor

						

			
Accessions: 6u9q_A (3D-footprint 20231221)

			
Names: B-cell CLL/lymphoma 11A, B-cell lymphoma/leukemia 11A, BC11A_HUMAN, BCL-11A, COUP-TF-interacting protein 1, Ecotropic viral integration site 9 protein homolog, EVI-9, Zinc finger protein 856
Organisms: Homo sapiens
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q9H165
Length: 89
Pfam Domains:      7-28 Zinc finger, C2H2 type
     7-28 C2H2-type zinc finger
     8-28 C2H2-type zinc finger
    20-44 Zinc-finger double domain
    34-56 C2H2-type zinc finger
    34-56 Zinc finger, C2H2 type
    49-73 Zinc-finger double domain
    63-85 C2H2-type zinc finger
    64-87 C2H2-type zinc finger
    64-87 Zinc finger, C2H2 type
Sequence: 
(in bold interface residues)		   1 EGRRSDTCEYCGKVFKNCSNLTVHRRSHTGERPYKCELCNYACAQSSKLTRHMKTHGQVG   60
  61 KDVYKCEICKMPFSVYSTLEKHMKKWHSD
Interface Residues: 16, 17, 18, 19, 20, 22, 23, 24, 25, 26, 29, 44, 45, 46, 47, 48, 49, 50, 51, 52, 55, 74, 75, 76, 77, 78, 79, 80, 81, 85
3D-footprint Homologues: 7n5w_A, 3uk3_C, 1tf3_A, 6jnm_A, 8cuc_F, 7y3l_A, 6ml4_A, 5v3j_F, 4x9j_A, 1llm_D, 6blw_A, 5kkq_D, 8ssu_A, 1ubd_C, 6u9q_A, 5ei9_F, 8gn3_A, 1mey_C, 5kl3_A, 7ysf_A, 1f2i_J, 6wmi_A, 2kmk_A, 7w1m_H, 5und_A, 2gli_A, 1g2f_F, 5k5l_F, 2lt7_A, 8ssq_A, 8h9h_G, 4m9v_C, 7eyi_G, 2i13_A, 8gh6_A, 7y3m_I, 6e94_A, 6a57_A, 2jpa_A, 2wbs_A, 5yel_A, 7txc_E, 2drp_D, 5yj3_D, 5k5i_A, 1tf6_A
Binding Motifs: 6u9q_A TGGTCAAg
Binding Sites: 6u9q_B
6u9q_C
			
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.