Transcription Factor
| Accessions: | HLF (HT-SELEX2 May2017), HLF_HUMAN (HOCOMOCO 10), Q16534 (JASPAR 2024) |
| Names: | ENSG00000108924, HLF, HLF_HUMAN |
| Organisms: | Homo sapiens |
| Libraries: | HT-SELEX2 May2017 1, HOCOMOCO 10 2, JASPAR 2024 3 1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] 2 Kulakovskiy IV, Vorontsov IE, Yevshin IS, Soboleva AV, Kasianov AS, Ashoor H, Ba-Alawi W, Bajic VB, Medvedeva YA, Kolpakov FA, Makeev VJ. HOCOMOCO: expansion and enhancement of the collection of transcription factor binding sites models. Nucleic Acids Res : (2016). [Pubmed] 3 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Notes: | TF family: bZIP experiment: HT-SELEX Hamming distance: 1 cycle: 4, TF family: bZIP experiment: Methyl-HT-SELEX Hamming distance: 1 cycle: 4 |
| Length: | 295 |
| Pfam Domains: | 224-277 Basic region leucine zipper |
| Sequence: (in bold interface residues) | 1 MEKMSRPLPLNPTFIPPPYGVLRSLLENPLKLPLHHEDAFSKDKDKEKKLDDESNSPTVP 60 61 QSAFLGPTLWDKTLPYDGDTFQLEYMDLEEFLSENGIPPSPSQHDHSPHPPGLQPASSAA 120 121 PSVMDLSSRASAPLHPGIPSPNCMQSPIRPGQLLPANRNTPSPIDPDTIQVPVGYEPDPA 180 181 DLALSSIPGQEMFDPRKRKFSEEELKPQPMIKKARKVFIPDDLKDDKYWARRRKNNMAAK 240 241 RSRDARRLKENQIAIRASFLEKENSALRQEVADLRKELGKCKNILAKYEARHGPL |
| Interface Residues: | 231, 232, 235, 236, 238, 239, 242, 243 |
| 3D-footprint Homologues: | 2wt7_A, 6mg1_B, 1nwq_C |
| Binding Motifs: | MA0043.2 yrTTAYrTAAym HLF_2 cgTTRYGYAAyr HLF_methyl_1 cgTTryGyAAyg HLF_HUMAN.H10MO.C|M01213 grTTryGTAAyms MA0043.1 krTTACryAAth MA0043.3 wdrTTATGYAAymw MA0043.4 TTATGYAAy |
| Binding Sites: | MA0043.1.1 MA0043.1.10 MA0043.1.11 MA0043.1.12 MA0043.1.13 MA0043.1.14 MA0043.1.15 MA0043.1.16 MA0043.1.17 MA0043.1.18 MA0043.1.2 MA0043.1.3 MA0043.1.4 MA0043.1.5 MA0043.1.6 MA0043.1.7 MA0043.1.8 MA0043.1.9 MA0043.3.1 MA0043.3.10 / MA0043.3.7 MA0043.3.11 / MA0043.3.8 MA0043.3.12 / MA0043.3.9 MA0043.3.10 / MA0043.3.13 MA0043.3.11 / MA0043.3.14 MA0043.3.15 MA0043.3.16 MA0043.3.17 MA0043.3.12 / MA0043.3.18 MA0043.3.19 MA0043.3.1 / MA0043.3.2 MA0043.3.20 MA0043.3.2 / MA0043.3.3 MA0043.3.4 MA0043.3.4 / MA0043.3.5 MA0043.3.5 / MA0043.3.6 MA0043.3.7 MA0043.3.8 MA0043.3.6 / MA0043.3.9 MA0043.3.13 MA0043.3.14 MA0043.3.15 MA0043.3.16 MA0043.3.17 MA0043.3.18 MA0043.3.19 MA0043.3.20 MA0043.3.3 MA0043.4.14 MA0043.4.15 / MA0043.4.20 / MA0043.4.5 MA0043.4.18 / MA0043.4.7 / MA0043.4.8 MA0043.4.6 MA0043.4.10 / MA0043.4.16 / MA0043.4.19 MA0043.4.1 / MA0043.4.2 MA0043.4.11 / MA0043.4.12 / MA0043.4.13 / MA0043.4.4 MA0043.4.17 MA0043.4.3 MA0043.4.9 |
| Publications: | Hunger S. P., Brown R., Cleary M. L. DNA-binding and transcriptional regulatory properties of hepatic leukemia factor (HLF) and the t(17;19) acute lymphoblastic leukemia chimera E2A-HLF. Mol. Cell. Biol. 14:5986-5996 (1994). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.