Transcription Factor

Accessions: 3coq_A (3D-footprint 20231221), 3coq_B (3D-footprint 20231221)
Names: GAL4_YEAST, Regulatory protein GAL4
Organisms: Saccharomyces cerevisiae, Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P04386
Length: 89
Pfam Domains: 2-40 Fungal Zn(2)-Cys(6) binuclear cluster domain
43-89 Gal4-like dimerisation domain
Sequence:
(in bold interface residues)
1 EQACDICRLKKLKCSKEKPKCAKCLKNNWECRYSPKTKRSPLTRAHLTEVESRLERLEQL 60
61 FLLIFPREDLDMILKMDSLQDIKALLTGL
Interface Residues: 10, 11, 12, 38, 40, 41, 44
3D-footprint Homologues: 1pyi_A, 1hwt_C, 7uik_T, 1zme_D, 1d66_B, 3coq_A, 6voy_C
Binding Motifs: 3coq_AB cGGnnnnnnnnnnnCCg
Binding Sites: 3coq_D
3coq_E
Publications: Hong M, Fitzgerald M.X, Harper S, Luo C, Speicher D.W, Marmorstein R. Structural basis for dimerization in DNA recognition by Gal4. Structure (London, England : 1993) 16:1019-26 (2008). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.