Transcription Factor

						

			
Accessions: ELF1_DBD (HumanTF 1.0)

			
Names: E74-like factor 1, ELF1, ELF1_HUMAN, ETS-related transcription factor Elf-1
Organisms: Homo sapiens
Libraries: HumanTF 1.0 1
1 Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Uniprot: P32519
Notes: Ensembl ID: ENSG00000120690; DNA-binding domain sequence; TF family: ETS; Clone source: MGC
Length: 133
Pfam Domains:    26-109 Ets-domain
Sequence: 
(in bold interface residues)		   1 MAPDSPATTPNISVKKKNKDGKGNTIYLWEFLLALLQDKATCPKYIKWTQREKGIFKLVD   60
  61 SKAVSRLWGKHKNKPDMNYETMGRALRYYYQRGILAKVEGQRLVYQFKEMPKDLIYINDE  120
 121 DPSSSIESSDPSL
Interface Residues: 35, 36, 37, 79, 80, 81, 82, 83, 84, 85, 87, 88, 102
3D-footprint Homologues: 7ef9_A, 8ee9_F, 4uno_A, 3jtg_A, 1dux_F, 3zp5_A, 7jsa_J, 4mhg_A, 2stt_A, 4iri_A, 1bc8_C, 4l18_B, 4lg0_B, 1yo5_C, 4bqa_A, 1awc_A
Binding Motifs: ELF1_DBD aACCCGGAAGTr
			
Publications: Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.