Transcription Factor

						

			
Accessions: 2kmk_A (3D-footprint 20231221)

			
Names: GFI1_RAT, Growth factor independent protein 1, Zinc finger protein Gfi-1
Organisms: Rattus norvegicus
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q07120
Length: 82
Pfam Domains:      2-24 C2H2-type zinc finger
     2-24 Zinc finger, C2H2 type
     2-21 Zinc-finger of C2H2 type
     4-20 C2H2-type zinc finger
    17-40 Zinc-finger double domain
    30-48 C2H2-type zinc finger
    30-52 Zinc finger, C2H2 type
    30-40 C2H2-type zinc finger
    45-68 Zinc-finger double domain
    57-80 C2H2-type zinc finger
    58-80 C2H2-type zinc finger
    58-80 Zinc finger, C2H2 type
Sequence: 
(in bold interface residues)		   1 SFDCKICGKSFKRSSTLSTHLLIHSDTRPYPCQYCGKRFHQKSDMKKHTFIHTGEKPHKC   60
  61 QVCGKAFSQSSNLITHSRKHTG
Interface Residues: 2, 12, 13, 14, 15, 16, 18, 19, 21, 22, 25, 40, 41, 42, 43, 44, 46, 47, 48, 68, 69, 70, 71, 72, 73, 74, 75, 76, 79
3D-footprint Homologues: 2kmk_A, 7n5w_A, 1tf3_A, 6jnm_A, 6ml4_A, 5v3j_F, 4x9j_A, 2i13_A, 8gn3_A, 1llm_D, 6blw_A, 5kkq_D, 1ubd_C, 6u9q_A, 5yel_A, 5ei9_F, 1mey_C, 5kl3_A, 2drp_D, 7ysf_A, 6wmi_A, 5k5i_A, 8ssq_A, 7w1m_H, 5und_A, 2gli_A, 1g2f_F, 8ssu_A, 8h9h_G, 7eyi_G, 6e94_A, 2lt7_A, 6a57_A, 2jpa_A, 3uk3_C, 8cuc_F, 7y3l_A, 2wbs_A, 7txc_E, 1f2i_J, 5yj3_D, 5k5l_F, 1tf6_A, 4m9v_C, 7y3m_I
Binding Motifs: 2kmk_A GGcAtTGAT
Binding Sites: 2kmk_B
2kmk_C
			
Publications: Lee S, Doddapaneni K, Hogue A, McGhee L, Meyers S, Wu Z. Solution structure of Gfi-1 zinc domain bound to consensus DNA. Journal of molecular biology 397:1055-66 (2010). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.