Transcription Factor
Accessions: | 1hdd_C (3D-footprint 20231221), 1hdd_D (3D-footprint 20231221) |
Names: | ENGRAILED HOMEODOMAIN, HMEN_DROME |
Organisms: | Drosophila melanogaster |
Libraries: | 3D-footprint 20231221 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
Uniprot: | P02836 |
Length: | 57 |
Pfam Domains: | 1-56 Homeobox domain |
Sequence: (in bold interface residues) | 1 RPRTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFQNKRAKIKKS |
Interface Residues: | 1, 2, 3, 41, 42, 44, 45, 48, 49, 52, 53, 56 |
3D-footprint Homologues: | 1zq3_P, 3lnq_A, 1jgg_B, 6m3d_C, 2lkx_A, 4cyc_A, 2r5y_A, 1b72_A, 5flv_I, 2hos_A, 7q3o_C, 1ig7_A, 5zjt_E, 4j19_B, 3a01_E, 2d5v_B, 5hod_A, 2ld5_A, 1puf_A, 6a8r_A, 3cmy_A, 2h1k_B, 5jlw_D, 3rkq_B, 6es3_K, 1au7_A, 4xrs_G, 3d1n_M, 2hdd_A, 1nk2_P, 7psx_B, 1fjl_B, 5zfz_A, 1le8_A, 1e3o_C, 6fqp_B, 3l1p_A, 1o4x_A, 1le8_B, 6fqq_E, 1du0_A, 8g87_X, 4qtr_D, 1mnm_C, 1puf_B, 1k61_B |
Binding Motifs: | 1hdd_CD TAnnnTnaTTAC |
Binding Sites: | 1hdd_A 1hdd_B |
Publications: | Kissinger C. R., Liu B., Martin-Blanco E., Kornberg T. B., Pabo C. O. Crystal structure of an engrailed homeodomain-DNA complex at 2.8 A resolution: a framework for understanding homeodomain-DNA interactions. Cell 63:579-590 (1990). [Pubmed] |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.