Transcription Factor
Accessions: | jim (FlyZincFinger 1.0 ) |
Names: | CG11352 |
Organisms: | Drosophila melanogaster |
Libraries: | FlyZincFinger 1.0 1 1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed] |
Notes: | family:Cys2His2 zinc finger |
Length: | 145 |
Pfam Domains: | 11-23 C2H2-type zinc finger 12-30 Zinc finger, C2H2 type 27-50 Zinc-finger double domain 40-62 C2H2-type zinc finger 40-62 Zinc finger, C2H2 type 40-60 C2H2-type zinc finger 54-78 Zinc-finger double domain 67-88 C2H2-type zinc finger 68-90 C2H2-type zinc finger 68-90 Zinc finger, C2H2 type 83-106 Zinc-finger double domain 96-118 C2H2-type zinc finger 96-118 Zinc finger, C2H2 type |
Sequence: (in bold interface residues) | 1 HKNKPHSDLRLFKCLTCGKDFKQKSTLLQHDRIHTDARPFPCSECGKRFRQQSHLTQHLR 60 61 IHANEKPFTCPYCSRSFRQRAILNQHIRIHSGEKPFACPECGKHFRQKAILNQHVRTHQD 120 121 VSPHLIFKNGPHPTLWPSDVPFPGE |
Interface Residues: | 12, 22, 23, 24, 25, 26, 28, 29, 31, 32, 33, 35, 50, 51, 52, 53, 54, 56, 57, 61, 64, 65, 78, 79, 80, 81, 82, 83, 84, 85, 86, 88, 106, 107, 108, 109, 110, 111, 112, 113, 114, 117 |
3D-footprint Homologues: | 2kmk_A, 5v3j_F, 1tf3_A, 7w1m_H, 8cuc_F, 8ssu_A, 2i13_A, 5kkq_D, 5ei9_F, 2drp_D, 8ssq_A, 1tf6_A, 2gli_A, 7eyi_G, 6e94_A, 7ysf_A, 6wmi_A, 2jpa_A, 1ubd_C, 7n5w_A, 3uk3_C, 6jnm_A, 6ml4_A, 4x9j_A, 1mey_C, 6blw_A, 6u9q_A, 5yel_A, 7txc_E, 5kl3_A, 1g2f_F, 5yj3_D, 5k5i_A, 5und_A, 8h9h_G, 2lt7_A, 6a57_A, 1yuj_A, 7y3l_A, 5k5l_F, 8gn3_A, 2wbs_A, 1f2i_J, 1llm_D, 4m9v_C, 7y3m_I |
Binding Motifs: | jim_F1-9_SOLEXA_2.5_FBgn0027339 rmAAaAAAAmmammm jim_SANGER_2.5_FBgn0027339 AAAAAAAamsA |
Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.