Transcription Factor

Accessions: jim (FlyZincFinger 1.0 )
Names: CG11352
Organisms: Drosophila melanogaster
Libraries: FlyZincFinger 1.0 1
1 Enuameh MS et al (2013) Global analysis of Drosophila Cys2-His2 zinc finger proteins reveals a multitude of novel recognition motifs and binding determinants. Genome Res. 23(6):928-40. doi: 10.1101/gr.151472.112 [Pubmed]
Notes: family:Cys2His2 zinc finger
Length: 145
Pfam Domains: 11-23 C2H2-type zinc finger
12-30 Zinc finger, C2H2 type
27-50 Zinc-finger double domain
40-62 C2H2-type zinc finger
40-62 Zinc finger, C2H2 type
40-60 C2H2-type zinc finger
54-78 Zinc-finger double domain
67-88 C2H2-type zinc finger
68-90 C2H2-type zinc finger
68-90 Zinc finger, C2H2 type
83-106 Zinc-finger double domain
96-118 C2H2-type zinc finger
96-118 Zinc finger, C2H2 type
Sequence:
(in bold interface residues)
1 HKNKPHSDLRLFKCLTCGKDFKQKSTLLQHDRIHTDARPFPCSECGKRFRQQSHLTQHLR 60
61 IHANEKPFTCPYCSRSFRQRAILNQHIRIHSGEKPFACPECGKHFRQKAILNQHVRTHQD 120
121 VSPHLIFKNGPHPTLWPSDVPFPGE
Interface Residues: 12, 22, 23, 24, 25, 26, 28, 29, 31, 32, 33, 35, 50, 51, 52, 53, 54, 56, 57, 61, 64, 65, 78, 79, 80, 81, 82, 83, 84, 85, 86, 88, 106, 107, 108, 109, 110, 111, 112, 113, 114, 117
3D-footprint Homologues: 2kmk_A, 1tf3_A, 5v3j_F, 7w1m_H, 8cuc_F, 8ssq_A, 2drp_D, 1tf6_A, 8ssu_A, 2gli_A, 5kkq_D, 5ei9_F, 7ysf_A, 6e94_A, 2jpa_A, 1ubd_C, 7n5w_A, 6jnm_A, 3uk3_C, 5k5i_A, 6ml4_A, 6blw_A, 6u9q_A, 5yel_A, 4x9j_A, 1g2f_F, 5yj3_D, 5kl3_A, 7txc_E, 8h9h_G, 2lt7_A, 6a57_A, 1yuj_A, 7y3l_A, 1f2i_J, 5k5l_F, 2wbs_A, 8gn3_A, 1llm_D, 4m9v_C, 7y3m_I
Binding Motifs: jim_F1-9_SOLEXA_2.5_FBgn0027339 rmAAaAAAAmmammm
jim_SANGER_2.5_FBgn0027339 AAAAAAAamsA
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.