Transcription Factor

Accessions: Q9BXK1 (JASPAR 2024)
Names: Basic transcription element-binding protein 4, BTE-binding protein 4, KLF16_HUMAN, Krueppel-like factor 16, Novel Sp1-like zinc finger transcription factor 2, Transcription factor BTEB4, Transcription factor NSLP2
Organisms: Homo sapiens
Libraries: JASPAR 2024 1
1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Uniprot: Q9BXK1
Length: 252
Pfam Domains: 127-151 C2H2-type zinc finger
127-151 Zinc finger, C2H2 type
143-169 Zinc-finger double domain
157-181 Zinc finger, C2H2 type
157-181 C2H2-type zinc finger
174-198 Zinc-finger double domain
187-209 Zinc finger, C2H2 type
187-209 C2H2-type zinc finger
Sequence:
(in bold interface residues)
1 MSAAVACVDYFAADVLMAISSGAVVHRGRPGPEGAGPAAGLDVRAARREAASPGTPGPPP 60
61 PPPAASGPGPGAAAAPHLLAASILADLRGGPGAAPGGASPASSSSAASSPSSGRAPGAAP 120
121 SAAAKSHRCPFPDCAKAYYKSSHLKSHLRTHTGERPFACDWQGCDKKFARSDELARHHRT 180
181 HTGEKRFSCPLCSKRFTRSDHLAKHARRHPGFHPDLLRRPGARSTSPSDSLPCSLAGSPA 240
241 PSPAPSPAPAGL
Interface Residues: 139, 140, 141, 142, 143, 145, 146, 148, 149, 152, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 197, 198, 199, 200, 201, 202, 203, 204, 205, 208, 223, 226, 227, 228, 229, 230
3D-footprint Homologues: 7n5w_A, 6jnm_A, 3uk3_C, 1tf3_A, 1tf6_A, 5ei9_F, 1g2f_F, 5kl3_A, 1ubd_C, 2kmk_A, 1llm_D, 7ysf_A, 6ml4_A, 8ssq_A, 7w1m_H, 6blw_A, 5k5l_F, 6u9q_A, 5yel_A, 2gli_A, 8ssu_A, 5kkq_D, 8h9h_G, 2lt7_A, 6e94_A, 6a57_A, 2jpa_A, 5k5i_A, 8gn3_A, 8cuc_F, 7y3l_A, 2wbs_A, 7txc_E, 2drp_D, 4x9j_A, 1f2i_J, 4m9v_C, 7y3m_I, 5yj3_D, 5v3j_F
Binding Motifs: MA0741.1 gmCMCgCCCMC
Publications: Lomberk G, Urrutia R. The family feud: turning off Sp1 by Sp1-like KLF proteins. Biochem J : (2005). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.