Transcription Factor

Accessions: 5x6m_E (3D-footprint 20241219), 5x6m_F (3D-footprint 20241219)
Names: Dwarfin-C, Dwf-C, MAD homolog 5, Mothers against decapentaplegic homolog 5, Mothers against DPP homolog 5, mSmad5, SMAD 5, SMAD family member 5, SMAD5_MOUSE
Organisms: Mus musculus
Libraries: 3D-footprint 20241219 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P97454
Length: 121
Pfam Domains: 20-120 MH1 domain
Sequence:
(in bold interface residues)
1 PAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSSPGQPSKCVTIPRSL 60
61 DGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLDICEFPFGSKQKEVCINPYHYKRVE 120
121 S
Interface Residues: 65, 66, 69
3D-footprint Homologues: 8k4l_B
Binding Motifs: 5x6m_E CGGCAG
5x6m_EF TGmCgnnaGTCT
Binding Sites: 5x6m_G
5x6m_H
Publications: Chai N, Li WX, Wang J, Wang ZX, Yang SM, Wu JW. Structural basis for the Smad5 MH1 domain to recognize different DNA sequences. Nucleic Acids Res 43:9051-64 (2015). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.