Transcription Factor
| Accessions: | SNAI2_HUMAN (HOCOMOCO 10), O43623 (JASPAR 2024) |
| Names: | Neural crest transcription factor Slug, Protein snail homolog 2, SNAI2_HUMAN, Zinc finger protein SNAI2 |
| Organisms: | Homo sapiens |
| Libraries: | HOCOMOCO 10 1, JASPAR 2024 2 1 Kulakovskiy IV, Vorontsov IE, Yevshin IS, Soboleva AV, Kasianov AS, Ashoor H, Ba-Alawi W, Bajic VB, Medvedeva YA, Kolpakov FA, Makeev VJ. HOCOMOCO: expansion and enhancement of the collection of transcription factor binding sites models. Nucleic Acids Res : (2016). [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Uniprot: | O43623 |
| Length: | 268 |
| Pfam Domains: | 128-150 Zinc finger, C2H2 type 128-149 C2H2-type zinc finger 128-152 C2H2-type zinc finger 159-181 Zinc finger, C2H2 type 159-181 C2H2-type zinc finger 159-181 C2H2-type zinc finger 173-196 Zinc-finger double domain 186-207 Zinc finger, C2H2 type 186-207 C2H2-type zinc finger 187-203 C2H2-type zinc finger 200-223 Zinc-finger double domain 213-235 C2H2-type zinc finger 213-235 Zinc finger, C2H2 type 213-235 C2H2-type zinc finger 213-233 Zinc-finger of C2H2 type 227-252 Zinc-finger double domain 241-256 C2H2-type zinc finger 241-262 Zinc finger, C2H2 type 241-261 C2H2-type zinc finger |
| Sequence: (in bold interface residues) | 1 MPRSFLVKKHFNASKKPNYSELDTHTVIISPYLYESYSMPVIPQPEILSSGAYSPITVWT 60 61 TAAPFHAQLPNGLSPLSGYSSSLGRVSPPPPSDTSSKDHSGSESPISDEEERLQSKLSDP 120 121 HAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYVSLGALKMHIRT 180 181 HTLPCVCKICGKAFSRPWLLQGHIRTHTGEKPFSCPHCNRAFADRSNLRAHLQTHSDVKK 240 241 YQCKNCSKTFSRMSLLHKHEESGCCVAH |
| Interface Residues: | 138, 139, 141, 142, 145, 149, 169, 170, 171, 172, 173, 175, 176, 178, 179, 182, 195, 196, 197, 198, 199, 201, 202, 203, 223, 224, 225, 226, 227, 228, 229, 230, 231, 234, 251, 252, 253, 254, 255, 257, 258 |
| 3D-footprint Homologues: | 7w1m_H, 8ssu_A, 5kkq_D, 8ssq_A, 5yel_A, 1ubd_C, 7n5w_A, 6jnm_A, 5ei9_F, 1g2f_F, 5kl3_A, 6ml4_A, 6blw_A, 4x9j_A, 8h9h_G, 6e94_A, 7ysf_A, 2gli_A, 6a57_A, 2jpa_A, 7y3l_A, 3uk3_C, 8cuc_F, 1tf3_A, 1f2i_J, 2wbs_A, 1tf6_A, 7txc_E, 5k5i_A, 2kmk_A, 1llm_D, 5v3j_F, 6u9q_A, 4m9v_C, 7y3m_I, 2lt7_A, 8gn3_A, 5yj3_D, 2drp_D, 5k5l_F |
| Binding Motifs: | MA0745.1 rrCAGGTGy SNAI2_HUMAN.H10MO.C|M01507 yCAGGTG MA0745.2 aygCACCTGTmry MA0745.3 gCACCTGT |
| Binding Sites: | MA0745.3.19 / MA0745.3.9 MA0745.3.13 / MA0745.3.7 / MA0745.3.8 MA0745.2.14 MA0745.2.15 MA0745.2.6 / MA0745.2.8 MA0745.2.7 / MA0745.2.9 MA0745.2.10 MA0745.2.1 MA0745.2.11 / MA0745.2.8 MA0745.2.12 MA0745.2.13 / MA0745.2.9 MA0745.2.10 / MA0745.2.14 MA0745.2.11 / MA0745.2.15 MA0745.2.16 MA0745.2.17 MA0745.2.18 MA0745.2.12 / MA0745.2.19 MA0745.2.1 / MA0745.2.2 MA0745.2.20 MA0745.2.3 MA0745.2.2 / MA0745.2.4 MA0745.2.3 / MA0745.2.5 MA0745.2.4 / MA0745.2.6 MA0745.2.5 / MA0745.2.7 MA0745.2.16 / MA0745.2.18 MA0745.2.13 MA0745.2.17 MA0745.2.19 MA0745.2.20 MA0745.3.5 MA0745.3.1 / MA0745.3.10 / MA0745.3.11 MA0745.3.12 / MA0745.3.20 / MA0745.3.3 / MA0745.3.4 MA0745.3.14 / MA0745.3.16 / MA0745.3.17 / MA0745.3.18 MA0745.3.15 / MA0745.3.6 MA0745.3.2 |
| Publications: | Jolma A, Yan J, Whitington T, Toivonen J, Nitta KR, Rastas P, Morgunova E, Enge M, Taipale M, Wei G, Palin K, Vaquerizas JM, Vincentelli R, Luscombe NM, Hughes TR, Lemaire P, Ukkonen E, Kivioja T, Taipale J. DNA-Binding Specificities of Human Transcription Factors. Cell. 2013 Jan 17;152(1-2):327-39. [Pubmed] Mistry DS, Chen Y, Wang Y, Zhang K, Sen GL. SNAI2 controls the undifferentiated state of human epidermal progenitor cells. Stem Cells 32:3209-18 (2014). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.