Transcription Factor
| Accessions: | ZNF32 (HT-SELEX2 May2017), P17041 (JASPAR 2024) |
| Names: | ENSG00000169740, ZNF32, C2H2-546, Zinc finger protein 32, Zinc finger protein KOX30, ZNF32_HUMAN |
| Organisms: | Homo sapiens |
| Libraries: | HT-SELEX2 May2017 1, JASPAR 2024 2 1 Yin Y, Morgunova E, Jolma A, Kaasinen E, Sahu B, Khund-Sayeed S, Das PK, Kivioja T, Dave K, Zhong F, Nitta KR, Taipale M, Popov A, Ginno PA, Domcke S, Yan J, Schübeler D, Vinson C, Taipale J. Impact of cytosine methylation on DNA binding specificities of human transcription factors. Science : (2017). [Pubmed] 2 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed] |
| Notes: | TF family: Znf_C2H2 experiment: HT-SELEX Hamming distance: 2 cycle: 4, TF family: Znf_C2H2 experiment: Methyl-HT-SELEX Hamming distance: 2 cycle: 4 |
| Length: | 273 |
| Pfam Domains: | 76-87 C2H2-type zinc finger 77-99 C2H2-type zinc finger 77-99 Zinc finger, C2H2 type 91-114 Zinc-finger double domain 104-125 C2H2-type zinc finger 105-127 C2H2-type zinc finger 105-127 Zinc finger, C2H2 type 119-143 Zinc-finger double domain 133-155 Zinc finger, C2H2 type 133-143 C2H2-type zinc finger 133-155 C2H2-type zinc finger 148-172 Zinc-finger double domain 160-184 C2H2-type zinc finger 161-183 Zinc finger, C2H2 type 161-183 C2H2-type zinc finger 175-199 Zinc-finger double domain 189-211 Zinc finger, C2H2 type 189-211 C2H2-type zinc finger 189-211 C2H2-type zinc finger 204-228 Zinc-finger double domain 217-228 C2H2-type zinc finger 237-256 Zinc-finger double domain 245-267 Zinc finger, C2H2 type 245-255 C2H2-type zinc finger 245-267 C2H2-type zinc finger |
| Sequence: (in bold interface residues) | 1 MFGFPTATLLDCHGRYAQNVAFFNVMTEAHHKYDHSEATGSSSWDIQNSFRREKLEQKSP 60 61 DSKTLQEDSPGVRQRVYECQECGKSFRQKGSLTLHERIHTGQKPFECTHCGKSFRAKGNL 120 121 VTHQRIHTGEKPYQCKECGKSFSQRGSLAVHERLHTGQKPYECAICQRSFRNQSNLAVHR 180 181 RVHSGEKPYRCDQCGKAFSQKGSLIVHIRVHTGLKPYACTQCRKSFHTRGNCILHGKIHT 240 241 GETPYLCGQCGKSFTQRGSLAVHQRSCSQRLTL |
| Interface Residues: | 77, 87, 88, 89, 90, 91, 94, 98, 115, 116, 118, 119, 121, 122, 124, 125, 126, 128, 143, 144, 145, 146, 147, 150, 153, 171, 172, 173, 174, 175, 177, 178, 179, 181, 184, 198, 200, 201, 202, 203, 204, 205, 206, 207, 210, 227, 228, 229, 230, 231, 232, 234, 255, 256, 258, 259 |
| 3D-footprint Homologues: | 2kmk_A, 7y3l_A, 1ubd_C, 8ssq_A, 7w1m_H, 8ssu_A, 1tf6_A, 6e94_A, 6jnm_A, 1tf3_A, 5yj3_D, 5ei9_F, 5k5i_A, 6ml4_A, 5v3j_F, 6blw_A, 5k5l_F, 6u9q_A, 5kkq_D, 8gn3_A, 7ysf_A, 2lt7_A, 6a57_A, 5yel_A, 2jpa_A, 7n5w_A, 8cuc_F, 1g2f_F, 5kl3_A, 4x9j_A, 2gli_A, 1f2i_J, 2wbs_A, 8h9h_G, 3uk3_C, 1llm_D, 2drp_D, 4m9v_C, 7y3m_I, 7txc_E |
| Binding Motifs: | UN0177.1 / ZNF32_2 ryGTAAymyGAyACs ZNF32_methyl_1 ryGTAAYcyGAyACc UN0177.2 GTAAymyGAyACs |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.