Transcription Factor

						

			
Accessions: 6j9c_D (3D-footprint 20231221)

			
Names: B3 domain-containing transcription factor LEC2, LEC2_ARATH, Protein LEAFY COTYLEDON 2
Organisms: Arabidopsis thaliana
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q1PFR7
Length: 112
Pfam Domains:    13-108 B3 DNA binding domain
Sequence: 
(in bold interface residues)		   1 STFDNKKLRVLCEKELKNSDVGSLGRIVLPKRDAEANLPKLSDKEGIVVQMRDVFSMQSW   60
  61 SFKYKFWSNNKSRMYVLENTGEFVKQNGAEIGDFLTIYEDESKNLYFAMNGN
Interface Residues: 17, 19, 24, 25, 26, 28, 67, 69, 70, 71, 72, 73, 74
3D-footprint Homologues: 6j9b_A, 6j9c_D, 6sdg_B, 6fas_B, 7et6_A
Binding Motifs: 6j9c_D tGCATG
Binding Sites: 6j9c_E
6j9c_F
			
Publications: Tao Z, Hu H, Luo X, Jia B, Du J, He Y. Embryonic resetting of the parental vernalized state by two B3 domain transcription factors in Arabidopsis. Nat Plants 5:424-435 (2019). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.