Transcription Factor
| Accessions: | 6j9c_D (3D-footprint 20250804) |
| Names: | B3 domain-containing transcription factor LEC2, LEC2_ARATH, Protein LEAFY COTYLEDON 2 |
| Organisms: | Arabidopsis thaliana |
| Libraries: | 3D-footprint 20250804 1 1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed] |
| Uniprot: | Q1PFR7 |
| Length: | 112 |
| Pfam Domains: | 13-108 B3 DNA binding domain |
| Sequence: (in bold interface residues) | 1 STFDNKKLRVLCEKELKNSDVGSLGRIVLPKRDAEANLPKLSDKEGIVVQMRDVFSMQSW 60 61 SFKYKFWSNNKSRMYVLENTGEFVKQNGAEIGDFLTIYEDESKNLYFAMNGN |
| Interface Residues: | 17, 19, 24, 25, 26, 28, 67, 69, 70, 71, 72, 73, 74 |
| 3D-footprint Homologues: | 6j9b_A, 7et6_A, 6fas_B, 6j9c_D, 8oj2_A |
| Binding Motifs: | 6j9c_D tGCATG |
| Binding Sites: | 6j9c_E 6j9c_F |
| Publications: | Tao Z, Hu H, Luo X, Jia B, Du J, He Y. Embryonic resetting of the parental vernalized state by two B3 domain transcription factors in Arabidopsis. Nat Plants 5:424-435 (2019). [Pubmed] |
| Related annotations: | PaperBLAST |
Disclaimer and license
These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.