Transcription Factor

						

			
Accessions: 2ql2_C (3D-footprint 20231221)

			
Names: Immunoglobulin enhancer-binding factor E12/E47, TCF-3, TFE2_MOUSE, Transcription factor 3, Transcription factor A1, Transcription factor E2-alpha
Organisms: Mus musculus
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: P15806
Length: 58
Pfam Domains:      1-52 Helix-loop-helix DNA-binding domain
Sequence: 
(in bold interface residues)		   1 RRMANNARERVRVRDINEAFRELGRMCQLHLKSDQTKLLILQQAVQVILGLEQQVRER
Interface Residues: 2, 5, 6, 8, 9, 10, 12, 13, 21, 25, 26
3D-footprint Homologues: 7z5k_B, 2ypa_A, 6od3_F, 2ql2_D, 2ypa_B, 2ql2_A, 1dct_B
Binding Motifs: 2ql2_CD CCAGntGG
			
Publications: Longo A, Guanga G.P, Rose R.B. Crystal structure of E47-NeuroD1/beta2 bHLH domain-DNA complex: heterodimer selectivity and DNA recognition. Biochemistry 47:218-29 (2008). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.