Transcription Factor

Accessions: P09021 (JASPAR 2024)
Names: Homeobox protein Hox-1.3, Homeobox protein Hox-A5, Homeobox protein M2, HXA5_MOUSE
Organisms: Mus musculus
Libraries: JASPAR 2024 1
1 Rauluseviciute I, Riudavets-Puig R, Blanc-Mathieu R, Castro-Mondragon JA, Ferenc K, Kumar V, Lemma RB, Lucas J, Cheneby J, Baranasic D, Khan A, Fornes O, Gundersen S, Johansen M, Hovig E, Lenhard B, Sandelin A, Wasserman WW, Parcy F, Mathelier A. JASPAR 2024: 20th anniversary of the open-access database of transcription factor binding profiles. Nucleic Acids Res : (2023). [Pubmed]
Length: 270
Pfam Domains: 196-252 Homeobox domain
Sequence:
(in bold interface residues)
1 MSSYFVNSFCGRYPNGPDYQLHNYGDHSSVSEQFRDSASMHSGRYGYGYNGMDLSVGRSG 60
61 SGHFGSGERARSYAAGASAAPAEPRYSQPATSTHSPPPDPLPCSAVAPSPGSDSHHGGKN 120
121 SLGNSSGASANAGSTHISSREGVGTASAAEEDAPASSEQAGAQSEPSPAPPAQPQIYPWM 180
181 RKLHISHDNIGGPEGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIK 240
241 IWFQNRRMKWKKDNKLKSMSMAAAGGAFRP
Interface Residues: 157, 158, 159, 162, 163, 178, 182, 196, 197, 198, 199, 237, 238, 240, 241, 244, 245, 247, 248, 249, 252
3D-footprint Homologues: 3d1n_M, 5zfz_A, 1puf_A, 1ig7_A, 8ejp_B, 6a8r_A, 8pmf_A, 1fjl_B, 3cmy_A, 1jgg_B, 3lnq_A, 1zq3_P, 2lkx_A, 6m3d_C, 7q3o_C, 2ld5_A, 1nk2_P, 6es3_K, 4cyc_A, 2r5y_A, 8osb_E, 7psx_B, 5hod_A, 2hos_A, 1puf_B, 5jlw_D, 8eml_B, 4xrs_G, 3a01_E, 9b8u_A, 3rkq_B, 8ik5_C, 5flv_I, 2hdd_A, 1b72_A, 5zjt_E, 2xsd_C, 1e3o_C, 7xrc_C, 1le8_A, 1mnm_C, 1du0_A, 4qtr_D, 1k61_B, 1o4x_A, 8bx1_A
Binding Motifs: PH0052.1 amgkTAATTAscwmar
Publications: Berger M.F, Badis G, Gehrke A.R, Talukder S, Philippakis A.A, Peña-Castillo L, Alleyne T.M, Mnaimneh S, Botvinnik O.B, Chan E.T, Khalid F, Zhang W, Newburger D, Jaeger S.A, Morris Q.D, Bulyk M.L, Hughes T.R. Variation in homeodomain DNA binding revealed by high-resolution analysis of sequence preferences. Cell 133:1266-76 (2008). [Pubmed]
Related annotations: PaperBLAST

Disclaimer and license

These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.