Transcription Factor

						

			
Accessions: 4iwr_A (3D-footprint 20231221), 4iwr_E (3D-footprint 20231221)

			
Names: Q8GGH0_9ENTR, Regulatory protein
Organisms: Enterobacter sp. RFL1396
Libraries: 3D-footprint 20231221 1
1 Contreras-Moreira B. 3D-footprint: a database for the structural analysis of protein-DNA complexes. Nucleic acids research 38:D91-7 (2010). [Pubmed]
Uniprot: Q8GGH0
Length: 75
Pfam Domains:     12-62 Helix-turn-helix domain
    12-62 Helix-turn-helix
Sequence: 
(in bold interface residues)		   1 ESFLLSKVSFVIKKIRLEKGMTQEDLAYKSNLDRTYISGIERNSRNLTIKSLELIMKGLE   60
  61 VSDVVFFEMLIKEIL
Interface Residues: 24, 33, 34, 35, 36, 38, 39, 42, 44, 45
3D-footprint Homologues: 3zkc_A, 8ity_P, 3s8q_A, 3u3w_B
Binding Motifs: 4iwr_AB TGTGACnnnnnnTCcG
4iwr_EF CGGAmnnnnnGTCACA
			
Publications: Martin RN, McGeehan JE, Ball NJ, Streeter SD, Thresh SJ, Kneale GG. Structural analysis of DNA-protein complexes regulating the restriction-modification system Esp1396I. Acta Crystallogr Sect F Struct Biol Cryst Commun : (2013). [Pubmed]
Related annotations: PaperBLAST

	
			


			

				

				
				
				
				

			

			

		

	
Disclaimer and license


These data are available AS IS and at your own risk. The EEAD/CSIC do not give any representation or warranty nor assume any liability or responsibility for the data nor the results posted (whether as to their accuracy, completeness, quality or otherwise). Access to these data is available free of charge for ordinary use in the course of research. Downloaded data have CC-BY-NC-SA license. FootprintDB is also available at RSAT::Plants, part of the INB/ELIXIR-ES resources portfolio.